Lus10022884 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024939 82 / 9e-23 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10022884 pacid=23160021 polypeptide=Lus10022884 locus=Lus10022884.g ID=Lus10022884.BGIv1.0 annot-version=v1.0
ATGAAGATAGCAGTGCCTCGCCATTTGTTCTCTGTTGCCAATGAATACTTGAGTGGAATTACGGTGGTTTGCATGGTGGTGGTGATGTGGTTGTGTATGG
GATCTTCTTACTGCTTGTTACTTGCTAGTAGCCAGAATTGTTCTCTGGTTTCAGTGGATTATGAGCACTGTTTGAAATATTGTTACTCGTCGTTGAGAGG
AAGTAACTAA
AA sequence
>Lus10022884 pacid=23160021 polypeptide=Lus10022884 locus=Lus10022884.g ID=Lus10022884.BGIv1.0 annot-version=v1.0
MKIAVPRHLFSVANEYLSGITVVCMVVVMWLCMGSSYCLLLASSQNCSLVSVDYEHCLKYCYSSLRGSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10022884 0 1
Lus10011723 7.3 0.8194
Lus10027664 10.9 0.8036
AT5G04480 UDP-Glycosyltransferase superf... Lus10017452 12.5 0.7957
Lus10024552 13.3 0.8030
Lus10005609 14.3 0.7999
AT1G13260 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING ... Lus10021707 17.3 0.7981
AT1G13940 Plant protein of unknown funct... Lus10026640 19.0 0.7550
AT3G48460 GDSL-like Lipase/Acylhydrolase... Lus10002389 20.7 0.7894
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10018918 20.8 0.7868
AT3G23880 F-box and associated interacti... Lus10010910 26.3 0.7796

Lus10022884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.