Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20420 195 / 1e-62 ATP citrate lyase (ACL) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008238 [exp] 202 / 4e-65 AT2G20420 766 / 0.0 ATP citrate lyase (ACL) family protein (.1) Lus10003620 [exp] 202 / 5e-65 AT2G20420 763 / 0.0 ATP citrate lyase (ACL) family protein (.1) Lus10024923 [exp] 182 / 2e-61 AT2G20420 176 / 3e-55 ATP citrate lyase (ACL) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G259600 [exp] 198 / 1e-63 AT2G20420 741 / 0.0 ATP citrate lyase (ACL) family protein (.1) Potri.014G195700 [exp] 194 / 3e-62 AT2G20420 745 / 0.0 ATP citrate lyase (ACL) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0506 [flax] [poplar] Succ_CoA_synth PF00549 [flax] [poplar] Ligase_CoA CoA-ligase
Representative CDS sequence Show only first row Show all	>Lus10022902 pacid=23159994 polypeptide=Lus10022902 locus=Lus10022902.g ID=Lus10022902.BGIv1.0 annot-version=v1.0 ATGATACAGATCAATCCCATTGCAGAAACTTCTGATAACAAATTGGTAGCAGCTGATGCTAAGATGAACTTCGATGATAATGCTGCTTTCCGTCAGAAGG AGTTATTTGCCCTTCGCGATCCTACGCAAGAGGATCCTCGAGAGGCGGCTGCTGCAAAGGCAGATTTGAATTACATCGGCCTCGATGGCGAGATTGGTTG CATGGTGAATGGCGCAGGGTTGGCAATGGCCACGATGGATATTATTAAACTGCATGGCGGAACTCCTGCCAATTTCCTCGATGTCGGTGGAAATGCTTCT GAATGA
AA sequence Show only first row Show all	>Lus10022902 pacid=23159994 polypeptide=Lus10022902 locus=Lus10022902.g ID=Lus10022902.BGIv1.0 annot-version=v1.0 MIQINPIAETSDNKLVAADAKMNFDDNAAFRQKELFALRDPTQEDPREAAAAKADLNYIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNAS E

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20420			ATP citrate lyase (ACL) family...		Lus10022902 [exp]	0	1
AT5G22450			unknown protein		Lus10000530 [exp]	2.2	1.0000
AT4G19540		INDH, INDL	IND1(iron-sulfur protein requi...		Lus10011951 [exp]	3.7	1.0000
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	3.9	1.0000
					Lus10024379 [exp]	4.5	1.0000
					Lus10003536 [exp]	4.7	1.0000
AT1G15150			MATE efflux family protein (.1...		Lus10013690 [exp]	4.9	1.0000
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Lus10037874 [exp]	5.0	1.0000
					Lus10023589 [exp]	5.2	1.0000
					Lus10011078 [exp]	5.3	1.0000
					Lus10030397 [exp]	5.5	1.0000

Compare expression of checked genes

Lus10022902 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.