Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74100 63 / 3e-13 SOT16, ATSOT16, CORI-7, ATST5A CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) AT1G18590 61 / 1e-12 SOT17, ATSOT17, ATST5C ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) AT1G74090 61 / 2e-12 SOT18, ATSOT18, ATST5B ARABIDOPSIS SULFOTRANSFERASE 5B, desulfo-glucosinolate sulfotransferase 18 (.1) AT3G45070 53 / 8e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G03750 52 / 1e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G28170 52 / 2e-09 SOT7 sulphotransferase 7 (.1) AT3G45080 52 / 2e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G27570 51 / 6e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G43690 49 / 3e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G13420 48 / 7e-08 SST1, ATST4B ARABIDOPSIS THALIANA SULFOTRANSFERASE 4B, sulfotransferase 4B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031621 [exp] 159 / 1e-50 AT1G74100 182 / 5e-56 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Lus10033721 [exp] 130 / 5e-37 AT1G18590 223 / 6e-67 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Lus10033720 [exp] 120 / 1e-34 AT1G74100 229 / 6e-73 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Lus10031623 [exp] 111 / 2e-31 AT2G03760 201 / 3e-62 ARABIDOPSIS THALIANA SULFOTRANSFERASE 1, sulphotransferase 12 (.1) Lus10031624 [exp] 98 / 3e-26 AT3G45070 209 / 2e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10003069 [exp] 91 / 8e-26 AT1G74090 60 / 4e-12 ARABIDOPSIS SULFOTRANSFERASE 5B, desulfo-glucosinolate sulfotransferase 18 (.1) Lus10034079 [exp] 92 / 3e-24 AT3G45070 206 / 1e-64 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10003070 [exp] 92 / 6e-24 AT3G45070 219 / 2e-69 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10018047 [exp] 89 / 1e-22 AT1G74100 208 / 7e-65 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G048200 [exp] 74 / 2e-17 AT1G18590 273 / 7e-90 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.011G048712 [exp] 73 / 8e-17 AT1G18590 265 / 1e-86 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.011G049100 [exp] 71 / 3e-16 AT1G18590 266 / 3e-87 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.011G048300 [exp] 71 / 5e-16 AT1G18590 244 / 1e-78 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.011G048100 [exp] 70 / 9e-16 AT1G74100 251 / 1e-81 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Potri.011G048400 [exp] 64 / 1e-13 AT1G18590 248 / 2e-80 ARABIDOPSIS SULFOTRANSFERASE 5C, sulfotransferase 17 (.1) Potri.003G193400 [exp] 63 / 3e-13 AT5G07010 393 / 6e-137 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1) Potri.003G193300 [exp] 62 / 4e-13 AT5G07010 378 / 4e-131 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1) Potri.012G032700 [exp] 59 / 1e-11 AT1G74100 295 / 4e-99 CORONATINE INDUCED-7, ARABIDOPSIS SULFOTRANSFERASE 5A, sulfotransferase 16 (.1) Potri.001G036600 [exp] 55 / 3e-10 AT5G07010 292 / 2e-97 ARABIDOPSIS THALIANA SULFOTRANSFERASE 2A, sulfotransferase 2A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00685 [flax] [poplar] Sulfotransfer_1 Sulfotransferase domain
Representative CDS sequence Show only first row Show all	>Lus10022904 pacid=23160039 polypeptide=Lus10022904 locus=Lus10022904.g ID=Lus10022904.BGIv1.0 annot-version=v1.0 ATGATATGGAGAAGCAGGTTCCACGGGCTTAAGGATTTGGACGGGAATAAAAACGGCAAGTCGTATCCGGAGGTGGCTCCGCTTCTGACGAACAACCTCT TCTTTCGGCGCGGTGAAGTCGGAGACTGGCGGAATCATTTGACGGGCGAGATGGCTAAAAGGATCGATGATGTTACGCGGGAGAAGTTTCGGTGCTGTGG GCTTTACCTTAACGACGAAGAGGCGGTTTGTACCACATAA
AA sequence Show only first row Show all	>Lus10022904 pacid=23160039 polypeptide=Lus10022904 locus=Lus10022904.g ID=Lus10022904.BGIv1.0 annot-version=v1.0 MIWRSRFHGLKDLDGNKNGKSYPEVAPLLTNNLFFRRGEVGDWRNHLTGEMAKRIDDVTREKFRCCGLYLNDEEAVCTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10022904 [exp]	0	1
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10031621 [exp]	3.2	0.9344
AT4G27130			Translation initiation factor ...		Lus10039660 [exp]	7.5	0.9127
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10030274 [exp]	7.7	0.9007
AT5G17680			disease resistance protein (TI...		Lus10041078 [exp]	8.8	0.8995
AT2G32090			Lactoylglutathione lyase / gly...		Lus10010552 [exp]	9.8	0.9029
AT2G37480			unknown protein		Lus10025314 [exp]	11.3	0.8973
AT1G17130			Family of unknown function (DU...		Lus10005575 [exp]	12.0	0.8924
AT2G45400		BEN1	NAD(P)-binding Rossmann-fold s...		Lus10004028 [exp]	12.4	0.8763
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10019732 [exp]	15.9	0.8267
AT2G39740		HESO1	HEN1 suppressor 1, Nucleotidyl...		Lus10001012 [exp]	18.3	0.8906

Compare expression of checked genes

Lus10022904 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.