Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61110 47 / 1e-06 NAC ANAC025 NAC domain containing protein 25 (.1) AT5G61430 44 / 1e-05 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G14000 44 / 1e-05 NAC ANAC084 NAC domain containing protein 84 (.1) AT3G18400 44 / 2e-05 NAC ANAC058 NAC domain containing protein 58 (.1) AT1G62700 44 / 2e-05 NAC ANAC026, VND5 VASCULAR RELATED NAC-DOMAIN PROTEIN 5, Arabidopsis NAC domain containing protein 26 (.1) AT3G04060 44 / 2e-05 NAC ANAC046 NAC domain containing protein 46 (.1) AT2G43000 43 / 3e-05 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT1G12260 43 / 4e-05 NAC ANAC007, VND4, EMB2749 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) AT2G33480 43 / 4e-05 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT2G24430 42 / 5e-05 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024907 [exp] 246 / 1e-84 AT5G62380 52 / 3e-08 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10036959 [exp] 67 / 3e-14 AT3G04070 82 / 8e-19 NAC domain containing protein 47 (.1.2) Lus10037106 [exp] 66 / 6e-14 AT3G04070 78 / 3e-17 NAC domain containing protein 47 (.1.2) Lus10009924 [exp] 62 / 3e-12 AT3G04070 62 / 1e-11 NAC domain containing protein 47 (.1.2) Lus10036955 [exp] 55 / 7e-10 AT3G15510 52 / 2e-08 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10031721 [exp] 50 / 2e-07 AT1G12260 353 / 4e-121 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10031142 [exp] 50 / 2e-07 AT1G12260 351 / 4e-120 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10010294 [exp] 48 / 8e-07 AT5G46590 59 / 1e-09 NAC domain containing protein 96 (.1) Lus10007204 [exp] 48 / 8e-07 ND 43 / 2e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G027900 [exp] 60 / 5e-11 AT2G24430 66 / 8e-12 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.006G028700 [exp] 55 / 3e-09 AT2G24430 65 / 1e-11 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.015G002900 [exp] 52 / 3e-08 AT1G71930 71 / 2e-13 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.017G031600 [exp] 50 / 1e-07 AT2G33480 90 / 3e-21 NAC domain containing protein 41 (.1.2) Potri.007G127700 [exp] 49 / 2e-07 AT5G13180 87 / 3e-20 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.019G063000 [exp] 48 / 3e-07 AT1G79580 56 / 4e-09 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.015G020000 [exp] 48 / 5e-07 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1) Potri.004G230800 [exp] 47 / 1e-06 AT2G02450 311 / 2e-103 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.006G029200 [exp] 47 / 1e-06 AT3G10480 67 / 8e-13 NAC domain containing protein 50 (.1.2.3) Potri.002G005800 [exp] 47 / 2e-06 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10022914 pacid=23159913 polypeptide=Lus10022914 locus=Lus10022914.g ID=Lus10022914.BGIv1.0 annot-version=v1.0 ATGAGGATTCCCGGAGCTCCGGTGGGTTACCGATTTCGCCCGTCCGGCGAACAAGTCATCGAGTACCTCGTCGATAAGGTCAAGGGCAATACTTTGCCCA GCGTGATCTTCGATGGTGATCTTTACGGAGAGGACGAAGTCTGGATTCGTCTCTTCAGCGAGACGAATGCTTCCGAGCTTTACTTCTGCACCAAATTGCC AAAGAAGAAGAAGAAAGGCGGCATTAGGGTAGCTAGAACGGTGGGAACGAAGGGCACGTGGACGTCCAGCCAGGATAAACCGGTTTACACCCGAGGCGTT CACATCGGTTCGAAGAGGTCTTTCTCGTACCAGGAGAAAGAGAAATCGGCGGCCGGCGGATTAAGGTTTGTGATGGATGAGTATCGCCTCGACGGAGTCC TTGGCGAGCATCCCGAGGCGGCGGAGGTCGTGATTTGCTGTGTAAGGAAGAAGGTGGAATCGAATCTATATCGATTGTGA
AA sequence Show only first row Show all	>Lus10022914 pacid=23159913 polypeptide=Lus10022914 locus=Lus10022914.g ID=Lus10022914.BGIv1.0 annot-version=v1.0 MRIPGAPVGYRFRPSGEQVIEYLVDKVKGNTLPSVIFDGDLYGEDEVWIRLFSETNASELYFCTKLPKKKKKGGIRVARTVGTKGTWTSSQDKPVYTRGV HIGSKRSFSYQEKEKSAAGGLRFVMDEYRLDGVLGEHPEAAEVVICCVRKKVESNLYRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10022914 [exp]	0	1
AT5G53000		TAP46	2A phosphatase associated prot...		Lus10041409 [exp]	16.3	0.8677
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10024010 [exp]	47.4	0.8454
AT1G04830			Ypt/Rab-GAP domain of gyp1p su...		Lus10037829 [exp]	47.9	0.8533
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Lus10000324 [exp]	50.6	0.8416
AT5G19930			Protein of unknown function DU...		Lus10033068 [exp]	73.4	0.8511
AT3G51830		ATG5, SAC8	SAC domain-containing protein ...		Lus10009080 [exp]	82.2	0.8504
AT1G18680			HNH endonuclease domain-contai...		Lus10003480 [exp]	95.7	0.8412
AT3G26090		ATRGS1, RGS1	REGULATOR OF G-PROTEIN SIGNALI...		Lus10006452 [exp]	138.0	0.8349
AT2G24580			FAD-dependent oxidoreductase f...		Lus10026933 [exp]	140.2	0.8373
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009398 [exp]	142.1	0.8323

Compare expression of checked genes

Lus10022914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.