Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28530 275 / 5e-91 NAC ANAC074 NAC domain containing protein 74 (.1.2) AT2G24430 199 / 4e-62 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT1G56010 199 / 6e-62 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) AT3G12977 194 / 1e-60 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G76420 195 / 3e-60 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G18400 192 / 3e-59 NAC ANAC058 NAC domain containing protein 58 (.1) AT5G53950 189 / 2e-57 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G61430 188 / 2e-57 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G07680 186 / 6e-57 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT3G15170 183 / 9e-56 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024908 [exp] 403 / 9e-143 AT4G28530 200 / 2e-62 NAC domain containing protein 74 (.1.2) Lus10033905 [exp] 318 / 2e-108 AT4G28530 271 / 2e-89 NAC domain containing protein 74 (.1.2) Lus10042466 [exp] 206 / 1e-63 AT1G56010 273 / 9e-90 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Lus10003548 [exp] 212 / 4e-62 AT1G08620 455 / 4e-142 Transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein (.1), Transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein (.2) Lus10005537 [exp] 190 / 2e-58 AT5G53950 317 / 3e-107 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10009029 [exp] 189 / 2e-57 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10009669 [exp] 187 / 8e-57 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1) Lus10041924 [exp] 181 / 3e-56 AT5G53950 281 / 9e-95 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10028372 [exp] 185 / 7e-56 AT2G18060 349 / 4e-119 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G037100 [exp] 332 / 9e-115 AT4G28530 276 / 6e-92 NAC domain containing protein 74 (.1.2) Potri.005G225800 [exp] 332 / 2e-114 AT4G28530 270 / 1e-89 NAC domain containing protein 74 (.1.2) Potri.005G098200 [exp] 205 / 2e-64 AT1G56010 332 / 6e-114 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.007G065400 [exp] 203 / 1e-63 AT1G56010 337 / 4e-116 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.005G255900 [exp] 197 / 2e-60 AT1G76420 295 / 4e-98 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.015G046800 [exp] 194 / 6e-60 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1) Potri.002G005800 [exp] 196 / 8e-60 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.006G277000 [exp] 193 / 2e-59 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.012G056300 [exp] 191 / 8e-59 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1) Potri.018G003800 [exp] 192 / 9e-59 AT2G24430 350 / 1e-120 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10022915 pacid=23159931 polypeptide=Lus10022915 locus=Lus10022915.g ID=Lus10022915.BGIv1.0 annot-version=v1.0 ATGGGGCTTCGAGACATTGGGGCGAGTTTGCCACCAGGGTTCAGGTTCTACCCGAGTGACGAGGAGCTGGTTTGTCATTACCTATTCAAGAAGATCTCCA ATGAGGAGGTCTTGAAGGGCACCCTTGTCGATATCGACTTGCACACCTGCGAACCTTGGCAGCTCCCTGAGGTGGCGAAGCTGAATGCGACAGAGTGGTA CTTCTTCAGCTTCAGGGACCGGAAATACGCGACGGGGTTCAGGACGAACAGGGCCACAACCTCCGGCTACTGGAAAGCGACGGGCAAAGATCGGACGGTG GTTGAACCGAACACCAAGGAGGTGGTAGGGATGAGGAAAACACTGGTTTTCTACAGGAACCGAGCTCCCAACGGCATCAAAACCGGCTGGATCATGCACG AGTTTCGACTCGAAACCCCCCATCTCCCTCCCAAGAAGGACTGGGTGTTATGTAGAGTGTTCCACAAAAGCAAGGCATCATCAGAAGACTACAACAATCT CAGCCCTCCTAATTACTATAATTACAACCCTACCCCTTTGGTCCAACCCAATCACCAGTGCCCTCTAACCAACAACGGCCAGCAGCTCGCCGTTCCGGCC ACCGGAGTATATGATCATCACCAACAACATCCACCGGCGGGGTCCTTGTTGAATCTTCTTCTTCAAGATAGAGAAAAGTTGTTGATGATGAACCATAAGG AGGATAGTAATCATGATGATCATAAGAGTAGTAACCCTCAGAGTGAGATCATCGTCAGCTCGAAACCGAGTAGTACTAATGATCAAGTGGACCAGTTTGC TGGGTTCTTGTGGGATGAGATGAACTTGGACGAGACGTGCAGCTTGGGAGATGGTGTCGTCGTGGGCTCCGATTTCGATGACATGAGATTTGATCACATT GACACCAACAACATGTTTTTGCTATGA
AA sequence Show only first row Show all	>Lus10022915 pacid=23159931 polypeptide=Lus10022915 locus=Lus10022915.g ID=Lus10022915.BGIv1.0 annot-version=v1.0 MGLRDIGASLPPGFRFYPSDEELVCHYLFKKISNEEVLKGTLVDIDLHTCEPWQLPEVAKLNATEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTV VEPNTKEVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLETPHLPPKKDWVLCRVFHKSKASSEDYNNLSPPNYYNYNPTPLVQPNHQCPLTNNGQQLAVPA TGVYDHHQQHPPAGSLLNLLLQDREKLLMMNHKEDSNHDDHKSSNPQSEIIVSSKPSSTNDQVDQFAGFLWDEMNLDETCSLGDGVVVGSDFDDMRFDHI DTNNMFLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Lus10022915 [exp]	0	1
AT4G20260		ATPCAP1	ARABIDOPSIS THALIANA PLASMA-ME...		Lus10038383 [exp]	2.4	0.9325
AT3G14240			Subtilase family protein (.1)		Lus10024814 [exp]	3.2	0.8957
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10038738 [exp]	4.7	0.9047
AT4G36890		IRX14	irregular xylem 14, Nucleotide...		Lus10033785 [exp]	5.3	0.8971
AT2G42760			unknown protein		Lus10005429 [exp]	5.5	0.9042
AT3G07510			unknown protein		Lus10038243 [exp]	7.1	0.8507
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Lus10039565 [exp]	7.5	0.8815
AT2G19760		PRF1, PFN1	profilin 1 (.1)		Lus10011138 [exp]	7.7	0.8681
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Lus10033609 [exp]	8.9	0.8736
AT4G40010		SNRK2-7, SNRK2....	SUCROSE NONFERMENTING 1-RELATE...		Lus10037685 [exp]	12.0	0.8803

Compare expression of checked genes

Lus10022915 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.