Lus10022928 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20515 167 / 9e-54 unknown protein
AT2G42840 42 / 4e-05 PDF1 protodermal factor 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024890 225 / 1e-76 AT2G20515 154 / 2e-48 unknown protein
Lus10026279 44 / 1e-05 AT2G16630 300 / 2e-100 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10042394 43 / 3e-05 AT2G16630 281 / 4e-93 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10007351 42 / 4e-05 AT2G42840 170 / 5e-51 protodermal factor 1 (.1)
Lus10007352 41 / 4e-05 AT2G42840 132 / 3e-39 protodermal factor 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G038200 176 / 3e-57 AT2G20515 189 / 2e-62 unknown protein
Potri.005G224600 171 / 2e-55 AT2G20515 177 / 8e-58 unknown protein
Potri.004G169200 46 / 3e-06 AT2G16630 186 / 1e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.005G200900 45 / 4e-06 AT2G42840 163 / 4e-48 protodermal factor 1 (.1)
Potri.002G060800 44 / 1e-05 AT2G42840 167 / 4e-50 protodermal factor 1 (.1)
PFAM info
Representative CDS sequence
>Lus10022928 pacid=23160042 polypeptide=Lus10022928 locus=Lus10022928.g ID=Lus10022928.BGIv1.0 annot-version=v1.0
ATGAAACACCAGCTCCGCTCCGCTCCTCTCCTCCGCCTCCTAATATGCATCCTCTTCTCCCTCTCCTCCGCAACCGCCCGTCCTGGCTTCCTCTACACCC
GAACCCGAGGCCGCTGCACTCCCCAGTTCTGGAGCAGCAGGAGGGAAGCGTGGCCGCGGATGGTGCCCCAAACGGCGACGGTTTCCAACGTCTTCGGCTC
CAGAGCACTCGAGAGGTACAGATCTGACTTAACCCTCCTCGAATCCGCCTCCCGAAACGACGACGTCGACAACCACCCTTACGTCCGCTTACTCCGCCAA
GGAACCGCCGCTCTGCTGAACTCCTACTCCAGAAGGCCGCTCTCCCCCTTCACGCCCTGGCAGGTAAAGACTCTGCTCATCCAAGGCCTCGTCTCCGAGT
CCGCTGCTTCTCGCCGCGCCGATCACTTCTCCGCCGCCAACAAGGCTTGTAGTTAA
AA sequence
>Lus10022928 pacid=23160042 polypeptide=Lus10022928 locus=Lus10022928.g ID=Lus10022928.BGIv1.0 annot-version=v1.0
MKHQLRSAPLLRLLICILFSLSSATARPGFLYTRTRGRCTPQFWSSRREAWPRMVPQTATVSNVFGSRALERYRSDLTLLESASRNDDVDNHPYVRLLRQ
GTAALLNSYSRRPLSPFTPWQVKTLLIQGLVSESAASRRADHFSAANKACS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20515 unknown protein Lus10022928 0 1
AT5G14920 Gibberellin-regulated family p... Lus10039443 2.8 0.9705
AT1G15190 Fasciclin-like arabinogalactan... Lus10023183 3.0 0.9481
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10021157 4.0 0.9659
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10032379 4.6 0.9614
Lus10010480 6.8 0.9340
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10020352 7.5 0.9517
AT2G20515 unknown protein Lus10024890 7.5 0.9378
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10040853 8.4 0.9562
AT2G30620 winged-helix DNA-binding trans... Lus10006562 10.2 0.9357
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10005892 10.7 0.9556

Lus10022928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.