Lus10022933 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31200 255 / 7e-89 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT5G59890 197 / 4e-66 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT1G01750 195 / 2e-65 ADF11 actin depolymerizing factor 11 (.1)
AT3G46010 196 / 3e-65 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT4G00680 190 / 3e-63 ADF8 actin depolymerizing factor 8 (.1)
AT2G16700 189 / 8e-63 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
AT4G34970 187 / 5e-62 ADF9 actin depolymerizing factor 9 (.1)
AT4G25590 184 / 1e-60 ADF7 actin depolymerizing factor 7 (.1)
AT5G59880 182 / 3e-60 ADF3 actin depolymerizing factor 3 (.1.2)
AT3G46000 181 / 8e-60 ADF2 actin depolymerizing factor 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024885 274 / 1e-96 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1)
Lus10024418 195 / 3e-65 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10024417 193 / 3e-64 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 193 / 3e-64 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025049 189 / 1e-62 AT2G16700 232 / 9e-80 actin depolymerizing factor 5 (.1.2)
Lus10008489 188 / 2e-62 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
Lus10040307 183 / 4e-58 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2)
Lus10023428 184 / 8e-58 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Lus10034494 176 / 8e-58 AT4G34970 202 / 2e-68 actin depolymerizing factor 9 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G223800 254 / 1e-88 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1)
Potri.002G038800 250 / 6e-87 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1)
Potri.008G052100 197 / 3e-66 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.004G173800 197 / 4e-66 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2)
Potri.009G133100 197 / 8e-66 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2)
Potri.001G236700 196 / 1e-65 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 193 / 2e-64 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 192 / 3e-64 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.009G028100 192 / 3e-64 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.001G106200 190 / 2e-63 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Lus10022933 pacid=23159996 polypeptide=Lus10022933 locus=Lus10022933.g ID=Lus10022933.BGIv1.0 annot-version=v1.0
ATGTCTTTCAGAGGACTCGCTCGGCCAAACGCCACCTCCGGGATGGGAGTCGCGGAGCAGAGCCTCCAAACATTCACGGAGCTGCAGAGGAAGAAGGTCC
ACCGTTACGTAGTCTTCAAGATCGACGAGAAGAAGAAACAGGTCATCGTCGAGAAAACCGGCGCTCCTGCTGAGAGCTACGAAGACTTCACCGCTTCCTT
ACCTGACAACGACTGCCGATACGCCATCTACGACTACGACTTCGTCACCCCCGACAACTGCCAGAAGAGCAAGATCTTCTTCTTCGCCTGGTCACCATCG
AGCTCCAGAATCAGGGCGAAAATGCTGTACGCGACGTCCAAGGATAGGTTCAGGAGGGAGCTTGACGGGATTCACTACGAGATCCAGGCTACCGATCCTA
CTGAACTGGATCTGGAGGTTCTTCAGGAACGTGCTAATTGA
AA sequence
>Lus10022933 pacid=23159996 polypeptide=Lus10022933 locus=Lus10022933.g ID=Lus10022933.BGIv1.0 annot-version=v1.0
MSFRGLARPNATSGMGVAEQSLQTFTELQRKKVHRYVVFKIDEKKKQVIVEKTGAPAESYEDFTASLPDNDCRYAIYDYDFVTPDNCQKSKIFFFAWSPS
SSRIRAKMLYATSKDRFRRELDGIHYEIQATDPTELDLEVLQERAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G31200 ADF6, ATADF6 actin depolymerizing factor 6 ... Lus10022933 0 1
AT2G24940 ATMAPR2 membrane-associated progestero... Lus10002241 1.0 0.8994
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10028700 2.4 0.8813
AT1G73500 ATMKK9 MAP kinase kinase 9 (.1) Lus10040127 3.5 0.8717
AT5G59550 zinc finger (C3HC4-type RING f... Lus10040783 5.5 0.8606
AT5G44060 unknown protein Lus10011797 5.5 0.8597
AT4G18700 ATWL4, CIPK12, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10025397 8.8 0.8580
AT1G73500 ATMKK9 MAP kinase kinase 9 (.1) Lus10040128 8.9 0.8525
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10011053 9.0 0.8212
AT3G15210 AP2_ERF ATERF4, RAP2.5... RELATED TO AP2 5, ethylene res... Lus10029987 10.1 0.8772
AT2G45630 D-isomer specific 2-hydroxyaci... Lus10041393 10.2 0.8538

Lus10022933 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.