Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022938 pacid=23160009 polypeptide=Lus10022938 locus=Lus10022938.g ID=Lus10022938.BGIv1.0 annot-version=v1.0 ATGAGGAAGGTGCTTCCACAAGATTGGGATACGTTCAGCTCCAGATTGGGATACGTTCAGCTTATCCAACCCAGAGCAATCTCTTGGCTATCTGTGGATG TTTGGCTAGTTAGCTGCTCAGTCAACCTATCAAGATTAGCTCTGACACAGAAATCCCCATTTGTTCCAAAAATCCAGCAGCAAGCAATGAAAAACTCTAT CAAATCAGTCTTCGAAACCGACCACCCACCGACGCCTGACCTGCCGCCATCCGCTGTCCGCCGTCTACACCCCGCCGCCGCCCAAAGGTAA
AA sequence Show only first row Show all	>Lus10022938 pacid=23160009 polypeptide=Lus10022938 locus=Lus10022938.g ID=Lus10022938.BGIv1.0 annot-version=v1.0 MRKVLPQDWDTFSSRLGYVQLIQPRAISWLSVDVWLVSCSVNLSRLALTQKSPFVPKIQQQAMKNSIKSVFETDHPPTPDLPPSAVRRLHPAAAQR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022938 [exp]	0	1
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10038672 [exp]	1.4	0.9025
					Lus10013650 [exp]	2.0	0.9027
AT1G28520	VOZ	ATVOZ1, VOZ1	vascular plant one zinc finger...		Lus10017700 [exp]	4.2	0.8499
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10006669 [exp]	4.6	0.8805
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10013916 [exp]	4.9	0.8617
					Lus10008904 [exp]	6.2	0.8180
AT5G11100		SYT4, NTMCTYPE2...	synaptotagmin 4, Calcium-depen...		Lus10041034 [exp]	6.3	0.8266
					Lus10004769 [exp]	6.7	0.8310
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10010105 [exp]	6.8	0.7654
AT5G44960			F-box/RNI-like/FBD-like domain...		Lus10015246 [exp]	7.1	0.8521

Compare expression of checked genes

Lus10022938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.