Lus10022958 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G03220 78 / 4e-17 Eukaryotic aspartyl protease family protein (.1)
AT1G03230 77 / 9e-17 Eukaryotic aspartyl protease family protein (.1)
AT5G19120 61 / 3e-11 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021939 224 / 9e-73 AT5G19120 228 / 4e-71 Eukaryotic aspartyl protease family protein (.1)
Lus10041004 198 / 2e-64 AT5G19120 104 / 4e-26 Eukaryotic aspartyl protease family protein (.1)
Lus10041224 84 / 3e-19 AT1G03220 527 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10021936 79 / 2e-17 AT1G03220 536 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10041223 78 / 5e-17 AT1G03220 525 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10021937 76 / 1e-16 AT1G03220 347 / 2e-117 Eukaryotic aspartyl protease family protein (.1)
Lus10036343 74 / 2e-15 AT1G03220 469 / 2e-164 Eukaryotic aspartyl protease family protein (.1)
Lus10021938 72 / 8e-15 AT1G03220 501 / 3e-176 Eukaryotic aspartyl protease family protein (.1)
Lus10041226 68 / 1e-13 AT1G03220 382 / 1e-130 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G203100 94 / 8e-23 AT1G03220 280 / 3e-90 Eukaryotic aspartyl protease family protein (.1)
Potri.002G054900 72 / 7e-15 AT1G03220 544 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.008G203200 70 / 2e-14 AT1G03220 509 / 6e-180 Eukaryotic aspartyl protease family protein (.1)
Potri.006G068900 70 / 3e-14 AT1G03220 456 / 5e-159 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065200 51 / 7e-08 AT1G03230 303 / 4e-99 Eukaryotic aspartyl protease family protein (.1)
Potri.019G064800 49 / 5e-07 AT1G03230 290 / 1e-93 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065000 48 / 1e-06 AT1G03220 309 / 3e-101 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065100 47 / 2e-06 AT1G03220 298 / 5e-97 Eukaryotic aspartyl protease family protein (.1)
Potri.013G070300 45 / 1e-05 AT1G03220 282 / 9e-91 Eukaryotic aspartyl protease family protein (.1)
Potri.013G070325 44 / 2e-05 AT1G03220 285 / 5e-92 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Lus10022958 pacid=23146140 polypeptide=Lus10022958 locus=Lus10022958.g ID=Lus10022958.BGIv1.0 annot-version=v1.0
ATGGTCTTGATCGCTTCTCTCCCACTTATCATTGTCTTTACCTCTCATCCACATCATCATGCCTCCTCCAATCTCCTCCTACTCCCTGTCGCCAAAGATC
CTGCCACTCACCAGTTCACTATCCTAATCCACCACCGTCCCCAACTCTTCATGCTCGTCGTCAATCTCGGTGGCCCTTCTCTCTGGGTTCACTGCTCATC
ACCTTACCACTTCAATCTCCTTCCATGCCGCTCAATCCAATGCACCAAGGGGAATTCCAACGTCGGTCATATTTTTGATAAAACCGCAGCTTGCCATGTC
GAAAACAGTAACGATGTCAGCGGGAGAAGATCTAATGGCCAGCTCCTGGATGACCCTATCGTCGTCCAATCGATCGACGGGTCAATGAGAACGGTTGACC
ACTTCATATTCTCTTGCGGGTCAACATTGATGCTGAACAGCCTAACAAGCGGCACTCTTGGAATGATTTCATTAGGAGGAAGAAAGAGCCAGTCTCCCCG
ACAGCGCAGTTCACGACAACATTCCGCTTCTTAA
AA sequence
>Lus10022958 pacid=23146140 polypeptide=Lus10022958 locus=Lus10022958.g ID=Lus10022958.BGIv1.0 annot-version=v1.0
MVLIASLPLIIVFTSHPHHHASSNLLLLPVAKDPATHQFTILIHHRPQLFMLVVNLGGPSLWVHCSSPYHFNLLPCRSIQCTKGNSNVGHIFDKTAACHV
ENSNDVSGRRSNGQLLDDPIVVQSIDGSMRTVDHFIFSCGSTLMLNSLTSGTLGMISLGGRKSQSPRQRSSRQHSAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G03230 Eukaryotic aspartyl protease f... Lus10022958 0 1

Lus10022958 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.