Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73120 64 / 2e-14 unknown protein AT3G19550 48 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013900 [exp] 52 / 5e-10 AT3G19550 50 / 6e-09 unknown protein Lus10013901 [exp] 49 / 1e-08 AT3G19550 79 / 4e-20 unknown protein Lus10002114 [exp] 45 / 1e-07 AT3G19550 77 / 2e-20 unknown protein Lus10002115 [exp] 45 / 1e-07 AT3G19550 77 / 2e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G248600 [exp] 85 / 9e-23 AT1G73120 102 / 3e-29 unknown protein Potri.001G296900 [exp] 43 / 2e-06 AT3G19550 83 / 7e-22 unknown protein Potri.009G091100 [exp] 40 / 2e-05 AT3G19550 84 / 2e-22 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10022961 pacid=23146144 polypeptide=Lus10022961 locus=Lus10022961.g ID=Lus10022961.BGIv1.0 annot-version=v1.0 ATGAACGTCATGTTCAAGCCAATGGTGAGGAAAGGTTACCACAAGAAGAGCTCCGGGTCCGGGGACACACTCAGTGGGCGGGAGAAGGCAGCCAAGGCAG AGCCGATGTCAGATGACGCAAGGAGCAAAGGAGGTTGTACTTGTTCCTGCTGGGTTCCAGACGACAAGACTGGGATTTACTACCCAAAAGGTCAGGAGAA AGTCATGGAAGGAATCCCTGTTGGAGCTGCCAAATATGCTGATGAGGTTCATTGGTACTCTGACAATTACCAAAATAATCATTGCTTTTAA
AA sequence Show only first row Show all	>Lus10022961 pacid=23146144 polypeptide=Lus10022961 locus=Lus10022961.g ID=Lus10022961.BGIv1.0 annot-version=v1.0 MNVMFKPMVRKGYHKKSSGSGDTLSGREKAAKAEPMSDDARSKGGCTCSCWVPDDKTGIYYPKGQEKVMEGIPVGAAKYADEVHWYSDNYQNNHCF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73120			unknown protein		Lus10022961 [exp]	0	1
					Lus10017551 [exp]	1.0	0.9811
AT5G55590		QRT1	QUARTET 1, Pectin lyase-like s...		Lus10016605 [exp]	2.0	0.9789
					Lus10014692 [exp]	2.4	0.9594
AT1G40087			Plant transposase (Ptta/En/Spm...		Lus10007402 [exp]	2.6	0.8994
					Lus10035120 [exp]	3.5	0.9556
AT5G11280			unknown protein		Lus10026797 [exp]	19.1	0.8323
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10024978 [exp]	20.0	0.8523
AT5G66580			unknown protein		Lus10000739 [exp]	20.6	0.8257
AT3G28470	MYB	TDF1, ATMYB35	DEFECTIVE IN MERISTEM DEVELOPM...		Lus10039462 [exp]	21.6	0.9099
AT5G26650	MADS	AGL36	AGAMOUS-like 36 (.1)		Lus10007592 [exp]	27.3	0.7942

Compare expression of checked genes

Lus10022961 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.