Lus10022962 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24070 293 / 9e-100 Peroxidase superfamily protein (.1)
AT2G43480 285 / 1e-96 Peroxidase superfamily protein (.1)
AT5G17820 171 / 5e-52 Peroxidase superfamily protein (.1)
AT3G03670 166 / 3e-50 Peroxidase superfamily protein (.1)
AT5G22410 156 / 2e-46 RHS18 root hair specific 18 (.1)
AT5G15180 155 / 9e-46 Peroxidase superfamily protein (.1)
AT5G51890 154 / 2e-45 Peroxidase superfamily protein (.1)
AT2G41480 152 / 8e-45 Peroxidase superfamily protein (.1)
AT3G01190 151 / 2e-44 Peroxidase superfamily protein (.1)
AT3G32980 152 / 3e-44 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004804 448 / 2e-160 AT5G24070 412 / 1e-144 Peroxidase superfamily protein (.1)
Lus10025586 328 / 2e-113 AT5G24070 418 / 6e-147 Peroxidase superfamily protein (.1)
Lus10018375 183 / 1e-56 AT5G17820 293 / 1e-98 Peroxidase superfamily protein (.1)
Lus10043010 179 / 7e-55 AT5G22410 300 / 9e-101 root hair specific 18 (.1)
Lus10032511 177 / 2e-54 AT5G22410 302 / 8e-102 root hair specific 18 (.1)
Lus10004859 174 / 2e-53 AT5G22410 309 / 1e-104 root hair specific 18 (.1)
Lus10013631 173 / 9e-53 AT5G17820 331 / 2e-113 Peroxidase superfamily protein (.1)
Lus10001324 171 / 5e-52 AT5G17820 327 / 6e-112 Peroxidase superfamily protein (.1)
Lus10005679 162 / 1e-48 AT4G26010 353 / 3e-122 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G132800 338 / 3e-117 AT2G43480 446 / 2e-158 Peroxidase superfamily protein (.1)
Potri.015G110200 198 / 1e-62 AT5G22410 340 / 1e-116 root hair specific 18 (.1)
Potri.013G066800 171 / 1e-51 AT4G26010 360 / 1e-124 Peroxidase superfamily protein (.1)
Potri.015G003500 159 / 2e-47 AT1G05260 291 / 1e-97 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.012G006800 159 / 3e-47 AT1G05260 291 / 2e-97 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.017G038100 156 / 3e-46 AT1G05260 479 / 7e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.018G089900 150 / 5e-44 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.001G218450 150 / 9e-44 AT5G22410 280 / 1e-92 root hair specific 18 (.1)
Potri.001G218500 150 / 9e-44 AT5G22410 280 / 1e-92 root hair specific 18 (.1)
Potri.007G122200 148 / 3e-43 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10022962 pacid=23146177 polypeptide=Lus10022962 locus=Lus10022962.g ID=Lus10022962.BGIv1.0 annot-version=v1.0
ATGGAGATAAGGTGCCCAGGCGTTGTCTCATGTGCAGACATCCTCAACCTTGCAACTAGAGATGCAGTTCACTTGGCAGGAGGTCCATCATATCCAGTCT
TGACTGGTAGAAAGGACGGCTTGATATCAACCGCGTCAAACGTCGATCTCCCATCACCTTCTATCTCCGCCAATGCTGCATTAGCCTACTTCCAATCTAG
GGGATTGGATGTTCTAGACATGGCCACTCTTTTAGGTGCCCATTCCATTGGTACGACCGACTGTCGCTACATCGTCGATCGGCTTTACAACTTCAAAAAC
ACAAAGAAGGCAGACCCCAGCATGAACAAACAATTGGCTGACCAACTCAGGAAGAAATGCCCTCCTCTATCAAACACTTACACCACCAACTCCTCGAGGG
TTTTTTTGAACCCAGATTCTGCAGATACCTACCAGCTCAGCAACTCCTACTATAAGAGGGCCTTGTCTTACCAATCCGTTCTAGGTGTCGACCAGCAGCT
ACTCTACACTAATGACACCCTACAAATCACCCAAGAATTTTCCCGGGCTGACGGCTTTGAAAACTGGAGAAGATCTGTCGCCCTCTCCATGGCTAGAATG
GGCAACATCAATGTCTTAACAGGGAATGCAGGGGAGATACGTAGGAATTGCAGATACACCAACAGTAAACTAAGTCATCTCATCTCAACATGA
AA sequence
>Lus10022962 pacid=23146177 polypeptide=Lus10022962 locus=Lus10022962.g ID=Lus10022962.BGIv1.0 annot-version=v1.0
MEIRCPGVVSCADILNLATRDAVHLAGGPSYPVLTGRKDGLISTASNVDLPSPSISANAALAYFQSRGLDVLDMATLLGAHSIGTTDCRYIVDRLYNFKN
TKKADPSMNKQLADQLRKKCPPLSNTYTTNSSRVFLNPDSADTYQLSNSYYKRALSYQSVLGVDQQLLYTNDTLQITQEFSRADGFENWRRSVALSMARM
GNINVLTGNAGEIRRNCRYTNSKLSHLIST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24070 Peroxidase superfamily protein... Lus10022962 0 1
AT5G24070 Peroxidase superfamily protein... Lus10025586 2.8 0.9509
AT5G21930 ATHMA8, HMA8, P... ARABIDOPSIS HEAVY METAL ATPASE... Lus10038070 7.1 0.9216
AT1G68150 WRKY ATWRKY9, WRKY9 WRKY DNA-binding protein 9 (.1... Lus10016682 7.2 0.9394
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10041975 8.4 0.9270
AT5G51980 C3HZnF Transducin/WD40 repeat-like su... Lus10038890 9.2 0.8919
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10009992 11.2 0.9388
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Lus10006199 13.9 0.9249
AT1G72890 Disease resistance protein (TI... Lus10042020 17.1 0.9328
AT5G16890 Exostosin family protein (.1) Lus10039145 18.2 0.8971
AT5G57090 MM31, ATPIN2, A... WAVY ROOTS 6, ETHYLENE INSENSI... Lus10001637 19.9 0.9367

Lus10022962 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.