Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59570 72 / 6e-16 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1) AT2G43490 71 / 1e-15 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6) AT4G27100 56 / 2e-10 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2) AT5G54780 56 / 2e-10 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1) AT4G28550 48 / 1e-07 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1) AT2G20440 41 / 5e-05 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004802 [exp] 82 / 1e-19 AT2G43490 499 / 2e-170 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6) Lus10011159 [exp] 57 / 1e-10 AT4G27100 634 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2) Lus10043064 [exp] 57 / 1e-10 AT2G20440 630 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2) Lus10022905 [exp] 43 / 7e-06 AT4G28550 621 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1) Lus10024920 [exp] 43 / 1e-05 AT4G28550 618 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G132900 [exp] 78 / 4e-18 AT2G43490 808 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6) Potri.017G023200 [exp] 77 / 1e-17 AT2G43490 795 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6) Potri.011G135300 [exp] 57 / 1e-10 AT4G27100 667 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2) Potri.001G419100 [exp] 51 / 1e-08 AT5G54780 663 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1) Potri.005G227400 [exp] 50 / 4e-08 AT4G28550 616 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00566 [flax] [poplar] RabGAP-TBC Rab-GTPase-TBC domain
Representative CDS sequence Show only first row Show all	>Lus10022963 pacid=23146158 polypeptide=Lus10022963 locus=Lus10022963.g ID=Lus10022963.BGIv1.0 annot-version=v1.0 ATGGCTTTGGACTCTGCACGGAATTGGTACGGAACCAACTTACTTCAATTTTCTAAGGTAAGTAGGAGCCAATTCTTGCCCTACGCTAACAACCTTGTTC ATGTCTCAGTTGTTGACGTGGTAAGAACAGACATTCATCTTGTATTCTACGAGGACAAGAAAAATTTGGCTAGAATGTCTGATATACTTGCGGTTTATGC CTGGATTGATCCTGCCACGGGTTATTGTCAAGTACTAGGAATCCTGTTAGCCGAAGCTCGTTGGAATACCTGTGATCTGTACGCGAGGAATTTACCAGAT GTTATTGATTGA
AA sequence Show only first row Show all	>Lus10022963 pacid=23146158 polypeptide=Lus10022963 locus=Lus10022963.g ID=Lus10022963.BGIv1.0 annot-version=v1.0 MALDSARNWYGTNLLQFSKVSRSQFLPYANNLVHVSVVDVVRTDIHLVFYEDKKNLARMSDILAVYAWIDPATGYCQVLGILLAEARWNTCDLYARNLPD VID

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G59570			Ypt/Rab-GAP domain of gyp1p su...		Lus10022963 [exp]	0	1
AT4G01995			unknown protein		Lus10016264 [exp]	3.9	0.7902
AT5G48840		ATPTS, PANC	ARABIDOPSIS THALIANA PANTOTHEN...		Lus10038167 [exp]	5.1	0.7424
AT5G36930			Disease resistance protein (TI...		Lus10000738 [exp]	6.2	0.7783
AT1G01020		ARV1	Arv1-like protein (.1.2)		Lus10007219 [exp]	6.9	0.7627
AT1G72890			Disease resistance protein (TI...		Lus10009384 [exp]	10.0	0.7701
					Lus10027391 [exp]	10.4	0.7733
AT1G17450			B-block binding subunit of TFI...		Lus10015659 [exp]	11.5	0.7605
AT1G33530			F-box family protein (.1)		Lus10014979 [exp]	13.7	0.6989
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	15.3	0.7693
AT2G14110			Haloacid dehalogenase-like hyd...		Lus10020444 [exp]	18.3	0.7137

Compare expression of checked genes

Lus10022963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.