Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035130 [exp] 65 / 3e-13 AT1G13680 437 / 7e-154 PLC-like phosphodiesterases superfamily protein (.1) Lus10031973 [exp] 64 / 3e-13 AT1G13680 435 / 1e-153 PLC-like phosphodiesterases superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10022970 pacid=23146143 polypeptide=Lus10022970 locus=Lus10022970.g ID=Lus10022970.BGIv1.0 annot-version=v1.0 ATGTCCATCTCCGCGTACGTGAAACCAATTTCTAATTCATCTCCGCAATTCAAACATTTCCCCATAAAAAAGTCGATTCAGATTGAGGTGGGTGTTATCG GCGACAGTATTCCTGAGTTGTTGTTCAACAGTAGCGTTTGGATGCTCGTCGAACCAAGATTGTGGGGTCGGACGCCACTGTTTCAGTTGCTTGGACACGA CGGAGTCGGGATGATCCTTCTTCAAATTGATTTGGTGAGGCCAAGGAGCAGAGGAGGAGGAGGAGGCCGAGGAGCAGAGGAGAGAATAAAGGGAGAAGCG ACGGGGAAAGATGGGAGAGGAGAAGGGCGAGGGAGATAG
AA sequence Show only first row Show all	>Lus10022970 pacid=23146143 polypeptide=Lus10022970 locus=Lus10022970.g ID=Lus10022970.BGIv1.0 annot-version=v1.0 MSISAYVKPISNSSPQFKHFPIKKSIQIEVGVIGDSIPELLFNSSVWMLVEPRLWGRTPLFQLLGHDGVGMILLQIDLVRPRSRGGGGGRGAEERIKGEA TGKDGRGEGRGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10022970 [exp]	0	1
AT3G57990			unknown protein		Lus10000401 [exp]	7.2	0.7558
AT5G05390		LAC12	laccase 12 (.1)		Lus10009841 [exp]	9.8	0.8227
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10022471 [exp]	10.8	0.8399
AT1G48120			hydrolases;protein serine/thre...		Lus10005957 [exp]	12.6	0.7507
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10016775 [exp]	13.6	0.8317
AT1G06330			Heavy metal transport/detoxifi...		Lus10013911 [exp]	14.1	0.8126
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Lus10027227 [exp]	23.0	0.8288
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10009340 [exp]	25.1	0.8087
AT5G44550			Uncharacterised protein family...		Lus10000781 [exp]	41.2	0.8109
AT5G23750			Remorin family protein (.1.2)		Lus10008014 [exp]	47.7	0.6890

Compare expression of checked genes

Lus10022970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.