Lus10022976 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06510 51 / 5e-09 SFR2, ATSFR2 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006100 115 / 7e-36 AT3G06510 55 / 2e-10 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
Lus10010837 115 / 7e-36 AT3G06510 55 / 2e-10 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
Lus10030186 115 / 7e-36 AT3G06510 55 / 2e-10 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
Lus10011147 116 / 4e-32 AT3G06510 826 / 0.0 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
Lus10043048 115 / 8e-32 AT3G06510 767 / 0.0 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G149500 62 / 5e-13 AT3G06510 832 / 0.0 SENSITIVE TO FREEZING 2, Glycosyl hydrolase superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10022976 pacid=23146153 polypeptide=Lus10022976 locus=Lus10022976.g ID=Lus10022976.BGIv1.0 annot-version=v1.0
ATGGCGTTCTTGACTCTCGTCGTGTCGGCCACCAAGGTCGCCGGCGTCTTAGTAAGCCTCACCGTCGCTTCCAACGCCATCTCTTTCTGGCGTTTCCAGA
AGAAGAATCTCAAGTCTTTCGAACCCGGTATTGACGAGACCTCAGAGATTCTGGCCGCTTTTAATGTCGACGGTAAATTCCTTCTTAAGCTTCTATCCAA
GTTCCCCAGCCTAGCCGCTGCTTAA
AA sequence
>Lus10022976 pacid=23146153 polypeptide=Lus10022976 locus=Lus10022976.g ID=Lus10022976.BGIv1.0 annot-version=v1.0
MAFLTLVVSATKVAGVLVSLTVASNAISFWRFQKKNLKSFEPGIDETSEILAAFNVDGKFLLKLLSKFPSLAAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06510 SFR2, ATSFR2 SENSITIVE TO FREEZING 2, Glyco... Lus10022976 0 1
AT3G06510 SFR2, ATSFR2 SENSITIVE TO FREEZING 2, Glyco... Lus10030186 1.4 0.9919
AT3G06510 SFR2, ATSFR2 SENSITIVE TO FREEZING 2, Glyco... Lus10006100 2.0 0.9916
AT3G06510 SFR2, ATSFR2 SENSITIVE TO FREEZING 2, Glyco... Lus10010837 3.0 0.9464
AT1G78060 Glycosyl hydrolase family prot... Lus10022374 11.2 0.8394
AT3G16000 MFP1 MAR binding filament-like prot... Lus10025769 17.4 0.8524
AT4G30825 Tetratricopeptide repeat (TPR)... Lus10036601 25.2 0.8311
AT5G51160 Ankyrin repeat family protein ... Lus10029008 34.1 0.8066
AT4G28080 Tetratricopeptide repeat (TPR)... Lus10036604 37.5 0.8049
AT5G49030 OVA2 ovule abortion 2, tRNA synthet... Lus10043413 39.7 0.8262
AT2G04360 unknown protein Lus10016084 43.1 0.8258

Lus10022976 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.