Lus10022977 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G60870 77 / 1e-18 MEE9 maternal effect embryo arrest 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G003600 106 / 3e-30 AT1G60870 100 / 1e-27 maternal effect embryo arrest 9 (.1)
Potri.016G004300 105 / 1e-29 AT1G60870 99 / 6e-27 maternal effect embryo arrest 9 (.1)
PFAM info
Representative CDS sequence
>Lus10022977 pacid=23146142 polypeptide=Lus10022977 locus=Lus10022977.g ID=Lus10022977.BGIv1.0 annot-version=v1.0
ATGGAGAATCTCATCGCCCAATTTACCCTGCTTTCCGACGAAGCTCTGCGCAACAACAACTTCGATCCTTCCCAAATCGACGACGATCTGATGAAGCTCT
TCGAAGTGGAAGCGTACAGGGCGTGGGCGGCGGTGGAGCTGGAGCAAGAGGAGGAAGCCATGGAGGCGGAGGAGGAGATGCAGCAGGCAGAGGAGGAGCT
CGAGTCTGCCATGGAAGAGGCGATGGAAGAGTTCAGGAGGTTCGAAGAGGAGATGAATGGGATGGAGAAGGAGGAATTGGAGGAATTGGAACAGAGGGCG
GAAAAGGCCAGGAGGATGGGGACGGTGATGGAGAAGGCCGCCACCGTGGCATCCAAAAAGTACATGGAGGCGGCGGGGAAGGCGGCCACCGCGTCAATGA
GAGCTGCTTGGAAAGGGATTTCATCTCACAAAGTTCACCCTTCTTAA
AA sequence
>Lus10022977 pacid=23146142 polypeptide=Lus10022977 locus=Lus10022977.g ID=Lus10022977.BGIv1.0 annot-version=v1.0
MENLIAQFTLLSDEALRNNNFDPSQIDDDLMKLFEVEAYRAWAAVELEQEEEAMEAEEEMQQAEEELESAMEEAMEEFRRFEEEMNGMEKEELEELEQRA
EKARRMGTVMEKAATVASKKYMEAAGKAATASMRAAWKGISSHKVHPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G60870 MEE9 maternal effect embryo arrest ... Lus10022977 0 1
AT5G42000 ORMDL family protein (.1.2) Lus10023031 4.9 0.7718
AT5G19590 Protein of unknown function, D... Lus10033088 5.2 0.7699
AT5G46720 AIG2-like (avirulence induced ... Lus10034712 6.8 0.8062
AT4G13540 unknown protein Lus10023697 8.1 0.7649
AT3G15360 ATHM4, ATM4, TR... ARABIDOPSIS THIOREDOXIN M-TYPE... Lus10014798 15.2 0.7370
AT5G50740 Heavy metal transport/detoxifi... Lus10038785 16.6 0.7672
AT2G36410 Family of unknown function (DU... Lus10014379 20.8 0.7417
AT5G62200 Embryo-specific protein 3, (AT... Lus10031684 21.8 0.7372
AT3G17020 Adenine nucleotide alpha hydro... Lus10016900 24.9 0.7488
AT3G27100 unknown protein Lus10012534 25.2 0.7436

Lus10022977 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.