Lus10022979 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38180 86 / 3e-20 FAR1_related FRS5 FAR1-related sequence 5 (.1)
AT4G38170 57 / 5e-10 FRS9 FAR1-related sequence 9 (.1)
AT2G43280 42 / 3e-05 FAR1_related Far-red impaired responsive (FAR1) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026732 50 / 2e-08 AT3G07500 88 / 2e-22 Far-red impaired responsive (FAR1) family protein (.1)
Lus10025517 45 / 2e-06 AT2G43280 87 / 1e-22 Far-red impaired responsive (FAR1) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G209000 108 / 7e-28 AT4G38180 1163 / 0.0 FAR1-related sequence 5 (.1)
Potri.009G170100 108 / 9e-28 AT4G38180 1145 / 0.0 FAR1-related sequence 5 (.1)
Potri.011G145800 78 / 3e-17 AT4G38180 1003 / 0.0 FAR1-related sequence 5 (.1)
Potri.005G257600 68 / 9e-14 AT4G38180 891 / 0.0 FAR1-related sequence 5 (.1)
Potri.004G209100 62 / 1e-11 AT4G38170 716 / 0.0 FAR1-related sequence 9 (.1)
Potri.002G239300 46 / 2e-06 AT2G43280 130 / 2e-37 Far-red impaired responsive (FAR1) family protein (.1)
Potri.007G128800 41 / 0.0001 AT3G07500 124 / 8e-35 Far-red impaired responsive (FAR1) family protein (.1)
Potri.017G029400 41 / 0.0001 AT2G43280 319 / 4e-112 Far-red impaired responsive (FAR1) family protein (.1)
Potri.014G176600 39 / 0.0004 AT4G12850 178 / 5e-57 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
Potri.007G128700 39 / 0.0007 AT3G07500 138 / 2e-40 Far-red impaired responsive (FAR1) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10022979 pacid=23146190 polypeptide=Lus10022979 locus=Lus10022979.g ID=Lus10022979.BGIv1.0 annot-version=v1.0
ATGGAAAATGAGGTGCTTGAATTCGATATAGGCTTAGGAAGTTTGAATGGTCGAAGCGACAGAGAAGATGACGCCATTGACATCGACCATTCCCTCGACG
ACGACGAAGACCAAAGCTCTCCCGCCGCCGCCACCACAGTCGCTTCTGGTGCAGAGATCTACGTCCCGGACACTTCACTCAATGATGGAAAATCCACTTC
GTTAAATCGTCAAAATAAGGGAGGATTGGCTGGTCTCAGTGGTAGAGAAAAGTGCAGCAGTGATAGTCGAGTACAGATATCCGGCCAACATTTGTCAGAG
GATGATGTGGACAAGAGGATCCAACAACTGACGAACAAAGTGAAGTGCGCGAGTCGAAAGTGTGAAGCATATAGGGGTAAGTTGTTGTCAGTTTTGAAAG
ACATAGAGGATCATAAACTACAGTTATCAATTAAAGTACAGAACATTAAAATCAGTATCAAAGATAGCTTGTAA
AA sequence
>Lus10022979 pacid=23146190 polypeptide=Lus10022979 locus=Lus10022979.g ID=Lus10022979.BGIv1.0 annot-version=v1.0
MENEVLEFDIGLGSLNGRSDREDDAIDIDHSLDDDEDQSSPAAATTVASGAEIYVPDTSLNDGKSTSLNRQNKGGLAGLSGREKCSSDSRVQISGQHLSE
DDVDKRIQQLTNKVKCASRKCEAYRGKLLSVLKDIEDHKLQLSIKVQNIKISIKDSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38180 FAR1_related FRS5 FAR1-related sequence 5 (.1) Lus10022979 0 1
AT2G30120 unknown protein Lus10042267 40.8 0.6121
AT2G02148 unknown protein Lus10031926 138.0 0.5670
AT3G54826 Zim17-type zinc finger protein... Lus10037983 225.0 0.5641

Lus10022979 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.