Lus10022998 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42000 67 / 7e-16 AtMT4a Arabidopsis thaliana metallothionein 4a, Plant EC metallothionein-like protein, family 15 (.1.2)
AT2G23240 61 / 6e-14 AtMT4b Arabidopsis thaliana metallothionein 4b, Plant EC metallothionein-like protein, family 15 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G206400 62 / 3e-14 AT2G42000 69 / 1e-16 Arabidopsis thaliana metallothionein 4a, Plant EC metallothionein-like protein, family 15 (.1.2)
Potri.009G167700 51 / 9e-10 AT2G23240 / Arabidopsis thaliana metallothionein 4b, Plant EC metallothionein-like protein, family 15 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0461 Metallothionein PF02068 Metallothio_PEC Plant PEC family metallothionein
Representative CDS sequence
>Lus10022998 pacid=23146191 polypeptide=Lus10022998 locus=Lus10022998.g ID=Lus10022998.BGIv1.0 annot-version=v1.0
ATGAAGAACTCAGCCGGAGGAGTGACAGGTGGTTGCAATGCTCTGTGCGGGTGCCCAGTTCCTTGCCCTGGCGGCAACTCGTGCGGATGCAGAACAAGCT
CCAAGATGGAAGGAGAGGAGCAGCATAGCAAGTGTTCTTGCGGGGAGCACTGTGGATGTAACCCATGCCGCTGCCAACAAGGAACAGAAGGCTCCGCCGG
AGGAACGATGAGGGTTGGGAAAGCTCACTGCAAGTGTGGCACTGGCTGCACCTGTCAAGCCTGCGCTGCTTAA
AA sequence
>Lus10022998 pacid=23146191 polypeptide=Lus10022998 locus=Lus10022998.g ID=Lus10022998.BGIv1.0 annot-version=v1.0
MKNSAGGVTGGCNALCGCPVPCPGGNSCGCRTSSKMEGEEQHSKCSCGEHCGCNPCRCQQGTEGSAGGTMRVGKAHCKCGTGCTCQACAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42000 AtMT4a Arabidopsis thaliana metalloth... Lus10022998 0 1
AT2G38540 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRA... Lus10022744 1.7 0.8498
AT1G48120 hydrolases;protein serine/thre... Lus10005957 2.2 0.8037
Lus10022528 2.4 0.8497
AT2G32460 MYB ATMYB101, AtM1 ARABIDOPSIS THALIANA MYB 1, my... Lus10035275 2.8 0.8154
AT5G03250 Phototropic-responsive NPH3 fa... Lus10009292 12.2 0.7357
AT4G14746 unknown protein Lus10035902 13.6 0.8486
AT3G57990 unknown protein Lus10000401 22.1 0.7123
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10041829 22.1 0.7658
AT1G21130 IGMT4 indole glucosinolate O-methylt... Lus10030187 22.3 0.7686
AT1G79860 ATROPGEF12, ROP... MATERNAL EFFECT EMBRYO ARREST ... Lus10037866 26.8 0.7647

Lus10022998 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.