Lus10023005 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023767 172 / 6e-54 ND /
Lus10034057 123 / 1e-37 ND /
Lus10016947 118 / 1e-35 ND /
Lus10006886 126 / 2e-35 ND /
Lus10007415 79 / 8e-18 ND /
Lus10038642 63 / 3e-13 ND /
Lus10007416 64 / 8e-13 ND /
Lus10026444 55 / 2e-09 ND /
Lus10027118 52 / 6e-09 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10023005 pacid=23146132 polypeptide=Lus10023005 locus=Lus10023005.g ID=Lus10023005.BGIv1.0 annot-version=v1.0
ATGGATCTTTCCTATGATCTCAGTGTTGCACCCTCAGAATATGGCGCCTTGACTACGACCATTGCGGATCTCACTCTTGGAAGCAAAAAACTCCCATGTA
TGTTCCGTCTCATCCATTTTTGGCGCACAGAGGCTATTGCCATAGGCGAGGTCCCCGCTGCAATACATACCTTGTGGATCAACCGTTCGGAAACACTTAT
CCAAGGCTATACGGAGCCATCTCATACATGGGATGTGTTTGTGCTCATGAACTTGGGTACGATCTACAAAATCCGCCAACCAACTCTCATTGCACCACGT
ACTGAGCCACGTGCTTGCCCGGGACATGTCTGCCTCTTCATACTTCCTGAGGACTTGCACATATCAGTGAAGAGGATCAATCGAAACCATTCTTTCCCCA
TGATAACTACAACATAG
AA sequence
>Lus10023005 pacid=23146132 polypeptide=Lus10023005 locus=Lus10023005.g ID=Lus10023005.BGIv1.0 annot-version=v1.0
MDLSYDLSVAPSEYGALTTTIADLTLGSKKLPCMFRLIHFWRTEAIAIGEVPAAIHTLWINRSETLIQGYTEPSHTWDVFVLMNLGTIYKIRQPTLIAPR
TEPRACPGHVCLFILPEDLHISVKRINRNHSFPMITTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10023005 0 1
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10014880 1.0 0.9457
Lus10023004 1.4 0.8969
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10028996 6.9 0.8519
AT3G15510 NAC ATNAC2, ANAC056... NAC-REGULATED SEED MORPHOLOGY ... Lus10007410 7.1 0.7424
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 8.2 0.7937
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 9.2 0.7937
Lus10014737 10.1 0.7937
AT4G16195 Plant self-incompatibility pro... Lus10019768 10.9 0.7937
Lus10021773 11.7 0.7937
AT4G27170 SESA4, AT2S4 seed storage albumin 4 (.1) Lus10040395 12.4 0.7937

Lus10023005 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.