Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09870 59 / 7e-13 SAUR-like auxin-responsive protein family (.1) AT2G28085 56 / 2e-11 SAUR-like auxin-responsive protein family (.1) AT1G56150 43 / 1e-06 SAUR-like auxin-responsive protein family (.1) AT1G79130 43 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT1G19840 43 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT1G16510 42 / 4e-06 SAUR-like auxin-responsive protein family (.1) AT1G29460 42 / 5e-06 SAUR-like auxin-responsive protein family (.1) AT3G12830 42 / 5e-06 SAUR-like auxin-responsive protein family (.1) AT1G20470 41 / 1e-05 SAUR-like auxin-responsive protein family (.1) AT2G24400 40 / 2e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001397 [exp] 148 / 8e-48 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10026532 [exp] 99 / 2e-28 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1) Lus10030263 [exp] 71 / 6e-17 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1) Lus10004014 [exp] 70 / 6e-17 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) Lus10026531 [exp] 69 / 3e-16 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1) Lus10013819 [exp] 67 / 1e-15 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1) Lus10021435 [exp] 65 / 1e-14 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1) Lus10016129 [exp] 64 / 1e-14 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1) Lus10016130 [exp] 64 / 3e-14 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G092400 [exp] 84 / 1e-22 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1) Potri.006G125100 [exp] 78 / 4e-20 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G226400 [exp] 65 / 6e-15 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 45 / 4e-07 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.008G003900 [exp] 44 / 6e-07 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1) Potri.010G253800 [exp] 44 / 1e-06 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 44 / 1e-06 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 43 / 1e-06 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 42 / 1e-06 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 42 / 5e-06 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10023011 pacid=23146152 polypeptide=Lus10023011 locus=Lus10023011.g ID=Lus10023011.BGIv1.0 annot-version=v1.0 ATGATGCCTGCGGATGTGAAAGAGGGATATTTCGTCGTGTGTGCTGTAAATGATGGTGAACCTAAGAGGCTTGATTACCTAGGTAACCCAGGCTTCACGA ACCTACTTGAATTGGCTGCGGAGGAATTCGGGCTTCGACAAGGTGGAGTGCTTTATGTTCCTTGCAGGTCTGTTGATCTCCAAAGGATTCTTGGAAACTG GAGAAAGGGAGCTCGTAACGGTACTGCAGGGTGGTTCTCGCAGTGA
AA sequence Show only first row Show all	>Lus10023011 pacid=23146152 polypeptide=Lus10023011 locus=Lus10023011.g ID=Lus10023011.BGIv1.0 annot-version=v1.0 MMPADVKEGYFVVCAVNDGEPKRLDYLGNPGFTNLLELAAEEFGLRQGGVLYVPCRSVDLQRILGNWRKGARNGTAGWFSQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09870			SAUR-like auxin-responsive pro...		Lus10023011 [exp]	0	1
					Lus10040920 [exp]	1.4	0.9123
AT3G28970		AAR3	antiauxin-resistant 3, Domain ...		Lus10005235 [exp]	5.1	0.9104
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10042328 [exp]	6.9	0.9022
AT3G13970		APG12B, APG12	AUTOPHAGY 12 B, AUTOPHAGY 12, ...		Lus10000432 [exp]	7.3	0.8909
AT3G08840			D-alanine--D-alanine ligase fa...		Lus10012211 [exp]	10.7	0.8932
					Lus10031246 [exp]	15.5	0.8578
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Lus10037992 [exp]	16.4	0.8747
AT3G23360			Protein phosphatase 2C family ...		Lus10021171 [exp]	16.9	0.8605
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10034468 [exp]	21.0	0.8996
AT4G26100		CKL1, CK1	casein kinase 1 (.1)		Lus10021580 [exp]	21.7	0.8827

Compare expression of checked genes

Lus10023011 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.