Lus10023012 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09870 71 / 1e-16 SAUR-like auxin-responsive protein family (.1)
AT2G28085 49 / 4e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001398 246 / 3e-85 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1)
Lus10004014 145 / 1e-45 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10030263 138 / 8e-43 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 131 / 4e-40 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026531 127 / 2e-38 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Lus10001397 65 / 3e-14 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10026532 61 / 1e-12 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10021436 56 / 2e-10 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Lus10023011 54 / 2e-10 AT3G09870 59 / 1e-12 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G092400 107 / 7e-31 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 107 / 9e-31 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.010G226400 60 / 3e-12 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 44 / 3e-06 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 43 / 8e-06 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 40 / 8e-05 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10023012 pacid=23146160 polypeptide=Lus10023012 locus=Lus10023012.g ID=Lus10023012.BGIv1.0 annot-version=v1.0
ATGCTGAACAAGGAAGAAAGCATCCAAGGCTTGGTGATGCTCAAGCTTTTCACAAGGAAGGTGCAAAGGGCTCTACTGCACAAGGCATCCAGAAGGGGGC
AGAGCCTGAAATGCATTCCAGAGTTAGAAGAAGACAATCAGTCCAGGAAAGTTGTTCCAAACGATGTGAAGAAAGGGCAGTTTGCCGTCACAGCAATCAA
AGATGGGAAAGCAAAGAGGTTCACTGTAAAGTTGGATTACCTGAATGATCCAGAGTTCTTGAGTTTGCTGGAACTGGCTGAAGAGGAATTTGGGTTCCGG
CAGGAAGGCGTTCTTGCTGTCCCTTGTCACCCCGAGGAGCTTCAGAAGATTCTACGAGGAGGGAAAATGAGAAGAACAAGTACAGATCGGGGGAAAATGA
GAAGAACAAGTACAGATTGGTAG
AA sequence
>Lus10023012 pacid=23146160 polypeptide=Lus10023012 locus=Lus10023012.g ID=Lus10023012.BGIv1.0 annot-version=v1.0
MLNKEESIQGLVMLKLFTRKVQRALLHKASRRGQSLKCIPELEEDNQSRKVVPNDVKKGQFAVTAIKDGKAKRFTVKLDYLNDPEFLSLLELAEEEFGFR
QEGVLAVPCHPEELQKILRGGKMRRTSTDRGKMRRTSTDW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09870 SAUR-like auxin-responsive pro... Lus10023012 0 1
AT5G56860 GATA GATA21, GNC GATA, nitrate-inducible, carbo... Lus10040556 6.5 0.8129
AT3G09870 SAUR-like auxin-responsive pro... Lus10001398 7.3 0.8231
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10028852 15.0 0.7818
AT1G67050 unknown protein Lus10028485 19.6 0.7863
AT1G58100 TCP TCP8 TCP domain protein 8, TCP fami... Lus10008444 26.8 0.7577
AT5G13720 Uncharacterised protein family... Lus10029480 29.2 0.8142
AT2G21340 MATE efflux family protein (.1... Lus10041955 33.0 0.8084
AT1G61350 ARM repeat superfamily protein... Lus10002598 34.6 0.7825
AT3G18890 AtTic62 translocon at the inner envelo... Lus10026321 35.0 0.8136
AT1G26220 Acyl-CoA N-acyltransferases (N... Lus10013061 36.6 0.8034

Lus10023012 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.