Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09860 87 / 2e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001400 [exp] 110 / 2e-32 AT3G09860 114 / 2e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G092100 [exp] 87 / 2e-23 AT3G09860 174 / 2e-58 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023014 pacid=23146134 polypeptide=Lus10023014 locus=Lus10023014.g ID=Lus10023014.BGIv1.0 annot-version=v1.0 ATGGAGAAGTACTTCGGAAATGCGTACAGAGGCGACCCTGGAGTTCCGCATGCGAAGCCGGCCCGGTTCTGGAACATATGGATAGGCTCTGCTACTTTCT CAGCTCTCACCTGGTTCAATCCTTACATTTGGCACTTCAACAACGAATTCAATGGAATGGGATGGGGAAGGATTTCCGCGAGTCGTATTATTACAACTGG CCTCACTACTTCAAATAGGTGGCCGCTTGACCATTCTGGTGAATCAAACTCTCTGTATTACTGCAGACACTGTCGTTGTTTGCTATGTTTCTTCTTCTGT GAATTAAACAACTCGAACCCTTTAGCCATTTTCCGTGAAACGCAGTAA
AA sequence Show only first row Show all	>Lus10023014 pacid=23146134 polypeptide=Lus10023014 locus=Lus10023014.g ID=Lus10023014.BGIv1.0 annot-version=v1.0 MEKYFGNAYRGDPGVPHAKPARFWNIWIGSATFSALTWFNPYIWHFNNEFNGMGWGRISASRIITTGLTTSNRWPLDHSGESNSLYYCRHCRCLLCFFFC ELNNSNPLAIFRETQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09860			unknown protein		Lus10023014 [exp]	0	1
AT2G17695			unknown protein		Lus10028386 [exp]	1.0	0.9218
AT2G41950			unknown protein		Lus10029301 [exp]	2.8	0.9029
AT2G28230			TATA-binding related factor (T...		Lus10030830 [exp]	4.5	0.8918
AT5G18100		CSD3	copper/zinc superoxide dismuta...		Lus10013615 [exp]	4.7	0.8907
AT4G13590			Uncharacterized protein family...		Lus10011763 [exp]	6.2	0.8672
AT2G38140		PSRP4	plastid-specific ribosomal pro...		Lus10004829 [exp]	6.3	0.9101
AT5G24314		PDE225, PTAC7	PIGMENT DEFECTIVE 225, plastid...		Lus10041454 [exp]	7.3	0.8921
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Lus10041888 [exp]	8.8	0.8891
AT4G21190		EMB1417	embryo defective 1417, Pentatr...		Lus10027535 [exp]	12.2	0.8751
AT4G09040			RNA-binding (RRM/RBD/RNP motif...		Lus10041138 [exp]	12.4	0.9090

Compare expression of checked genes

Lus10023014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.