Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62770 46 / 7e-07 ATATG18A autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3) AT3G56440 39 / 0.0004 ATATG18D homolog of yeast autophagy 18 (ATG18) D (.1) AT2G40810 38 / 0.0005 ATATG18C homolog of yeast autophagy 18C (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002504 [exp] 111 / 4e-32 ND / Lus10032492 [exp] 103 / 3e-30 ND / Lus10010849 [exp] 99 / 1e-27 ND / Lus10016867 [exp] 97 / 1e-27 ND / Lus10021853 [exp] 100 / 2e-27 ND / Lus10005768 [exp] 93 / 7e-24 AT5G52140 90 / 7e-21 RING/U-box superfamily protein (.1) Lus10015574 [exp] 89 / 4e-23 ND / Lus10021608 [exp] 84 / 5e-23 ND / Lus10038559 [exp] 87 / 4e-22 AT2G34585 67 / 1e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G018400 [exp] 50 / 3e-08 AT3G62770 496 / 6e-176 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3) Potri.005G026600 [exp] 49 / 1e-07 AT3G62770 491 / 7e-174 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3) Potri.014G132300 [exp] 46 / 7e-07 AT3G62770 565 / 0.0 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3) Potri.002G207865 [exp] 46 / 1e-06 AT3G62770 596 / 0.0 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3) Potri.019G062800 [exp] 43 / 1e-05 AT2G40810 609 / 0.0 homolog of yeast autophagy 18C (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023022 pacid=23146128 polypeptide=Lus10023022 locus=Lus10023022.g ID=Lus10023022.BGIv1.0 annot-version=v1.0 ATGAGCCATTCGGGAAGTTATAGTGACGATGATGATGTTGAGGAACAGTTGAATTATAGTGTTTATTTCATCAATGGGGTGTTTTACGACACGGTCGATG ACATGTGTGATGCGGCTAAGGACCTTGCTTTAGACTTAGGGTTTCAATTAACTCGTGGTTCACATAAAAGAACCCCTGTGAAGAAGAAAAACGGTTGTAC TTGTATTACTCGCATGGTGGCAGAGGAAAATTATAGTCCATTGCCTCTTCAGAGAGTTCACAAGGGGCAGATTCGGGTAGAGAATTATGGTTCTAAGATG ATGAAGTTCGTAATCGCTCATGATTCGAGGCTAGCTTGTACGTAG
AA sequence Show only first row Show all	>Lus10023022 pacid=23146128 polypeptide=Lus10023022 locus=Lus10023022.g ID=Lus10023022.BGIv1.0 annot-version=v1.0 MSHSGSYSDDDDVEEQLNYSVYFINGVFYDTVDDMCDAAKDLALDLGFQLTRGSHKRTPVKKKNGCTCITRMVAEENYSPLPLQRVHKGQIRVENYGSKM MKFVIAHDSRLACT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	0	1
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	2.4	0.9965
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	3.5	0.9965
					Lus10036275 [exp]	3.9	0.9473
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	4.2	0.9965
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	4.9	0.9951
					Lus10029472 [exp]	5.1	0.8493
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	5.5	0.9950
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	6.0	0.9942
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	7.0	0.9925
AT5G54010			UDP-Glycosyltransferase superf...		Lus10008453 [exp]	7.5	0.9924

Compare expression of checked genes

Lus10023022 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.