Lus10023026 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42850 150 / 7e-48 Thioredoxin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037477 225 / 2e-77 AT5G42850 160 / 9e-52 Thioredoxin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G225500 197 / 3e-66 AT5G42850 171 / 4e-56 Thioredoxin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF06110 DUF953 Eukaryotic protein of unknown function (DUF953)
Representative CDS sequence
>Lus10023026 pacid=23170385 polypeptide=Lus10023026 locus=Lus10023026.g ID=Lus10023026.BGIv1.0 annot-version=v1.0
ATGACTGTCAAAATTGTGGACGCGACGGTTGCGAGCTTCAACGAGGTGTTCGAGAAGTTCAAATCAGAGTCGCCGAAATTCAAATCCAACCTCATCCTCT
TCCTCGCCGACAACGATCCTGCCACCAATATCAGCTGGTGCCCCGATTGCGTGAGGGCGGAGCCGGTGATAAAGAAGAAGCTGGAAGCTTCCGGCGATGA
CGTGGCGCTCCTTCGAGCTTACGTTGGGGACAGACCCACTTGGAGGAACCCACACCATCCTTTGAGGGTGGACTCGAAGTTCAAGCTGACTGGTGTCCCG
ACTCTGATCCGCTGGGAGGATGATGCTGTTAAAGGAAAGCTTGAGGATCATGAAGCTCACCTTGAACGCAAAATCGATGCACTTCTATCTGCTACCAAGT
AA
AA sequence
>Lus10023026 pacid=23170385 polypeptide=Lus10023026 locus=Lus10023026.g ID=Lus10023026.BGIv1.0 annot-version=v1.0
MTVKIVDATVASFNEVFEKFKSESPKFKSNLILFLADNDPATNISWCPDCVRAEPVIKKKLEASGDDVALLRAYVGDRPTWRNPHHPLRVDSKFKLTGVP
TLIRWEDDAVKGKLEDHEAHLERKIDALLSATK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42850 Thioredoxin superfamily protei... Lus10023026 0 1
AT1G08650 ATPPCK1, PPCK1 phosphoenolpyruvate carboxylas... Lus10042560 4.6 0.7069
AT3G03550 RING/U-box superfamily protein... Lus10009264 6.3 0.6882
AT1G64700 unknown protein Lus10001663 11.6 0.7363
Lus10031351 15.0 0.7197
AT1G44750 ATPUP11 purine permease 11 (.1.2.3) Lus10019503 20.2 0.6527
AT2G24940 ATMAPR2 membrane-associated progestero... Lus10002241 20.3 0.7164
AT3G04570 AT-hook AHL19 AT-hook motif nuclear-localize... Lus10042551 26.7 0.5734
AT5G45320 unknown protein Lus10035675 28.6 0.6607
AT5G36930 Disease resistance protein (TI... Lus10026845 30.9 0.7035
AT5G09310 unknown protein Lus10041297 32.4 0.6509

Lus10023026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.