Lus10023031 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42000 270 / 2e-94 ORMDL family protein (.1.2)
AT1G01230 253 / 1e-87 ORMDL family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033219 319 / 5e-114 AT5G42000 271 / 5e-95 ORMDL family protein (.1.2)
Lus10005980 258 / 9e-90 AT1G01230 295 / 1e-104 ORMDL family protein (.1)
Lus10030232 243 / 8e-77 AT1G09880 661 / 0.0 Rhamnogalacturonate lyase family protein (.1)
Lus10003209 212 / 3e-72 AT5G42000 194 / 2e-65 ORMDL family protein (.1.2)
Lus10017314 210 / 7e-71 AT5G42000 197 / 3e-66 ORMDL family protein (.1.2)
Lus10031614 83 / 2e-21 AT2G40190 81 / 1e-20 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G144600 282 / 2e-99 AT5G42000 281 / 8e-99 ORMDL family protein (.1.2)
Potri.001G086300 276 / 6e-97 AT5G42000 273 / 1e-95 ORMDL family protein (.1.2)
Potri.002G174400 261 / 9e-91 AT1G01230 254 / 3e-88 ORMDL family protein (.1)
Potri.014G101000 259 / 4e-90 AT1G01230 285 / 3e-100 ORMDL family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04061 ORMDL ORMDL family
Representative CDS sequence
>Lus10023031 pacid=23170327 polypeptide=Lus10023031 locus=Lus10023031.g ID=Lus10023031.BGIv1.0 annot-version=v1.0
ATGTACGTGAGAGCAGATCCCTCGACGGATTTGAATCGGAACACCGAATGGTTCACCTATCCAGGCGTCTGGACTACTTACATCGGCATCCTTTTCGCCT
CCTGGTTCATGGTTATCTGCCTCCTCGGCTGCTCCCCCGGCACCGCTTGGACCGTCGTCCATCTCGCCCACTTCATAATTACATACCACTTCTTTCACTG
GAAGAAGGGAACTCCATTTGCTGACGACCAAGGTATCTACAATGGGTTGACATGGTGGGAGCAAATAGAGAACGGGAAGCAGCTAACACGTAATAGGAAG
TTTCTCACTATTGTACCAGTTGTGCTATATCTGATAGCCTCACACACCACAAACTACCAAAATCCAATGCTGTTCTTCAACACAATGGCCGTATTCGTGC
TGGTCGTCGCAAAGTTCCCTCACATGCACAAAGTTAGGATTTTCGGGATCAATGCCGACTTCTGA
AA sequence
>Lus10023031 pacid=23170327 polypeptide=Lus10023031 locus=Lus10023031.g ID=Lus10023031.BGIv1.0 annot-version=v1.0
MYVRADPSTDLNRNTEWFTYPGVWTTYIGILFASWFMVICLLGCSPGTAWTVVHLAHFIITYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRK
FLTIVPVVLYLIASHTTNYQNPMLFFNTMAVFVLVVAKFPHMHKVRIFGINADF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42000 ORMDL family protein (.1.2) Lus10023031 0 1
AT5G62200 Embryo-specific protein 3, (AT... Lus10031684 1.0 0.8620
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10032561 3.2 0.8247
AT1G60870 MEE9 maternal effect embryo arrest ... Lus10022977 4.9 0.7718
AT3G19960 ATM1, ATATM myosin 1 (.1.2) Lus10010172 4.9 0.8126
AT2G36680 Modifier of rudimentary (Mod(r... Lus10023888 6.0 0.8051
AT4G00950 MEE47 maternal effect embryo arrest ... Lus10030238 6.2 0.7491
AT5G54680 bHLH bHLH105, ILR3 iaa-leucine resistant3, basic ... Lus10043076 10.5 0.7728
AT3G01270 Pectate lyase family protein (... Lus10023623 12.0 0.7784
AT4G36960 RNA-binding (RRM/RBD/RNP motif... Lus10009360 12.0 0.7720
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10024417 15.3 0.7914

Lus10023031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.