Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10810 56 / 6e-12 unknown protein AT4G24030 49 / 5e-09 unknown protein AT4G24026 48 / 8e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032433 [exp] 89 / 8e-23 ND 50 / 6e-08 Lus10012620 [exp] 41 / 3e-06 AT4G10810 62 / 2e-14 unknown protein Lus10010114 [exp] 40 / 3e-05 AT4G10810 63 / 5e-13 unknown protein Lus10022380 [exp] 39 / 4e-05 AT4G10810 60 / 2e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G087200 [exp] 70 / 2e-17 AT4G10810 60 / 2e-13 unknown protein Potri.003G143800 [exp] 65 / 1e-15 AT4G10810 60 / 2e-13 unknown protein Potri.002G173700 [exp] 47 / 2e-08 AT4G10810 69 / 8e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023038 pacid=23170341 polypeptide=Lus10023038 locus=Lus10023038.g ID=Lus10023038.BGIv1.0 annot-version=v1.0 ATGGAAAACAAAGAAGCCAATGACGACACCGCGAGCATCGTCTCGGTGGACAGCATAAACAACATGGCCAGCTGGGTTAGCACCACCGTGATATCCGCCT TTTTCTCCTCTCTGGAGCGATTCTCCTGCGTCAACATCCAAACCGCCGATATCGACGACGATGACGATGAGGGCGATGTTCGCCCTCTCAGACTTCACTC CACCTCTTCTCACAGCACCGTCGACGAGCTCCCGGTCTGA
AA sequence Show only first row Show all	>Lus10023038 pacid=23170341 polypeptide=Lus10023038 locus=Lus10023038.g ID=Lus10023038.BGIv1.0 annot-version=v1.0 MENKEANDDTASIVSVDSINNMASWVSTTVISAFFSSLERFSCVNIQTADIDDDDDEGDVRPLRLHSTSSHSTVDELPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10810			unknown protein		Lus10023038 [exp]	0	1
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10030436 [exp]	1.0	0.9152
AT5G28040	GeBP		DNA-binding storekeeper protei...		Lus10015944 [exp]	1.4	0.9138
AT3G08780			unknown protein		Lus10022677 [exp]	3.5	0.8841
AT1G65720			unknown protein		Lus10020795 [exp]	4.8	0.8459
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10022671 [exp]	5.2	0.8672
AT1G12310			Calcium-binding EF-hand family...		Lus10028915 [exp]	5.9	0.8716
AT3G62580			Late embryogenesis abundant pr...		Lus10025037 [exp]	6.9	0.8457
AT3G14180	Trihelix	ASIL2	Arabidopsis 6B-interacting pr...		Lus10025406 [exp]	9.2	0.8629
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032482 [exp]	9.4	0.8773
AT1G08315			ARM repeat superfamily protein...		Lus10039500 [exp]	10.6	0.8601

Compare expression of checked genes

Lus10023038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.