Lus10023045 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59030 80 / 2e-19 COPT1 copper transporter 1 (.1)
AT2G26975 79 / 3e-19 Ctr copper transporter family (.1)
AT5G59040 74 / 3e-17 COPT3 copper transporter 3 (.1)
AT3G46900 72 / 1e-16 COPT2 copper transporter 2 (.1)
AT2G37925 71 / 5e-16 COPT4 copper transporter 4 (.1)
AT5G20650 46 / 7e-07 COPT5 copper transporter 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032428 209 / 2e-70 AT2G26975 87 / 1e-22 Ctr copper transporter family (.1)
Lus10021107 120 / 1e-35 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017205 119 / 3e-35 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Lus10016464 91 / 1e-23 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10040726 80 / 2e-19 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10021108 74 / 5e-17 AT2G37925 120 / 2e-35 copper transporter 4 (.1)
Lus10017204 52 / 2e-09 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Lus10007092 52 / 6e-09 AT5G20650 169 / 6e-55 copper transporter 5 (.1)
Lus10012501 48 / 2e-07 AT5G20650 177 / 5e-58 copper transporter 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G093200 119 / 4e-35 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.009G038700 91 / 8e-24 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093300 81 / 3e-20 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.009G038800 75 / 1e-17 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.001G246000 71 / 5e-16 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.006G140700 50 / 3e-08 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
Potri.006G219200 42 / 3e-05 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10023045 pacid=23170334 polypeptide=Lus10023045 locus=Lus10023045.g ID=Lus10023045.BGIv1.0 annot-version=v1.0
ATGCCGATGGGACCAGGGACAATGTCTCCCGGCGGCGGAGACAACAACATGAACATGAACATGAGCATGGACAACGACTACAACATGATGCATAGCAGCT
TGTTCTGGGGGAAAGACGCTATAGTCCTCTTCTCCGGATGGCCCAACCACAGCCTACCCATGTACATACTCGCCTGCTTCTTCGTCTTCTCCATGGCCGC
TTCGATCGAGCTCCTCAACATCCATAAGCTTCCCACCCGCCCTGTTGTCGAGGCGTGTGTCTATGCCCTGAGGATGACTGTTGCTTACTTGCTCATGCTA
TCTGTCATGTCCTTCAATATCGGCATCTTTTTGGCTGCTGTGATCGGCCATTCTGTCGGGATGTTCGTCGCCAAGGTTCGTGCTAATCGTGCGGCTGTGA
TGGTCGATGGCCGCCGGATGCCTGACGGAGATGCCAAGATTTGA
AA sequence
>Lus10023045 pacid=23170334 polypeptide=Lus10023045 locus=Lus10023045.g ID=Lus10023045.BGIv1.0 annot-version=v1.0
MPMGPGTMSPGGGDNNMNMNMSMDNDYNMMHSSLFWGKDAIVLFSGWPNHSLPMYILACFFVFSMAASIELLNIHKLPTRPVVEACVYALRMTVAYLLML
SVMSFNIGIFLAAVIGHSVGMFVAKVRANRAAVMVDGRRMPDGDAKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G26975 Ctr copper transporter family ... Lus10023045 0 1
AT5G28237 Pyridoxal-5'-phosphate-depende... Lus10008278 3.9 0.7814
Lus10035468 4.2 0.7660
AT4G00350 MATE efflux family protein (.1... Lus10036374 4.9 0.8226
AT5G43190 Galactose oxidase/kelch repeat... Lus10007740 7.5 0.8125
AT1G80245 Spc97 / Spc98 family of spindl... Lus10018344 9.2 0.6401
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10023037 10.9 0.7432
AT4G02340 alpha/beta-Hydrolases superfam... Lus10008682 11.8 0.7812
AT1G65450 HXXXD-type acyl-transferase fa... Lus10029920 14.5 0.7787
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10034348 15.9 0.7787
AT1G02030 C2H2ZnF C2H2-like zinc finger protein ... Lus10031166 16.6 0.7598

Lus10023045 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.