Lus10023054 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64510 226 / 4e-75 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032419 391 / 4e-140 AT1G64510 241 / 6e-81 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G088300 246 / 5e-83 AT1G64510 263 / 3e-90 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01250 Ribosomal_S6 Ribosomal protein S6
Representative CDS sequence
>Lus10023054 pacid=23170393 polypeptide=Lus10023054 locus=Lus10023054.g ID=Lus10023054.BGIv1.0 annot-version=v1.0
ATGGCGTCCTCAGCAGTTTCGTCTGCTCTATTCTACTCCCCAATTTGCTCCAAATCTCTTTCGAAGTCCAACCCATCACCTTCGTCAGCATTTCTTGGGC
GGTTTAATGCGAATGCGACGGTGATTGTCCACCGTGTGAGAGACCGCGAAAGCGTGGTGAAGGCACAGACATTTGATTTCTCCGGTTCGTTCTATGGAGG
AAGGTTTGCCTCCGACGACGACGACGACGATGACGACAACGAACCTCCGATGCAGGGCACCCTGATGGAAATGGAGAAAAGAGAGACCCCTCCTTGCCCG
CCTGGGCTGCGACAGTACGAGACCATGTCTGTGTTGAGGCCGGACATGTCTGAAGATGAACGGCTTGCTCTTACACAGAAGTACGAAGAGTTGCTTGTAG
CTGGGGGTGGGATGTATGTGGAGGCATTCAACAGAGGAGTGCTTCCACTATCCTACAGCATCAAGAAGAAGAACAAAGCTGGTGAAACCAACACCTATAT
GGATGGGATCTACCTCCTCTTCACTTACTTCACAAAACCAGAATCCTTGAACGCCCTAGAAACAACTATGAATACTGATGATGACGTGATCCGACACAGC
ACTTTCAAAATCAGGAAGAGGAAGATAGATCTTCCCTATGAATCCGATGAATACGCTACTGAGGTAGAGGCTGGACTATGA
AA sequence
>Lus10023054 pacid=23170393 polypeptide=Lus10023054 locus=Lus10023054.g ID=Lus10023054.BGIv1.0 annot-version=v1.0
MASSAVSSALFYSPICSKSLSKSNPSPSSAFLGRFNANATVIVHRVRDRESVVKAQTFDFSGSFYGGRFASDDDDDDDDNEPPMQGTLMEMEKRETPPCP
PGLRQYETMSVLRPDMSEDERLALTQKYEELLVAGGGMYVEAFNRGVLPLSYSIKKKNKAGETNTYMDGIYLLFTYFTKPESLNALETTMNTDDDVIRHS
TFKIRKRKIDLPYESDEYATEVEAGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64510 Translation elongation factor... Lus10023054 0 1
AT1G64510 Translation elongation factor... Lus10032419 2.0 0.9733
AT1G29070 Ribosomal protein L34 (.1) Lus10013928 2.0 0.9780
AT3G15520 Cyclophilin-like peptidyl-prol... Lus10038601 2.4 0.9676
AT5G39530 Protein of unknown function (D... Lus10024051 2.8 0.9711
AT3G08920 Rhodanese/Cell cycle control p... Lus10004811 3.9 0.9697
AT1G07320 EMB2784, RPL4 EMBRYO DEFECTIVE 2784, ribosom... Lus10040693 4.9 0.9649
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10038770 5.7 0.9719
AT2G43030 Ribosomal protein L3 family pr... Lus10013640 6.0 0.9643
AT3G56910 PSRP5 plastid-specific 50S ribosomal... Lus10037307 7.0 0.9654
AT2G43030 Ribosomal protein L3 family pr... Lus10001337 7.4 0.9632

Lus10023054 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.