Lus10023061 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10920 116 / 2e-33 KELP transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
AT5G09250 57 / 2e-11 KIWI ssDNA-binding transcriptional regulator (.1.2)
AT4G00980 56 / 2e-09 zinc knuckle (CCHC-type) family protein (.1)
AT5G09240 46 / 9e-07 ssDNA-binding transcriptional regulator (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032410 201 / 9e-67 AT4G10920 169 / 2e-54 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Lus10030245 82 / 3e-20 AT4G10920 136 / 3e-41 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Lus10003998 69 / 4e-14 AT4G00980 226 / 9e-68 zinc knuckle (CCHC-type) family protein (.1)
Lus10013733 57 / 3e-11 AT5G09250 139 / 2e-44 ssDNA-binding transcriptional regulator (.1.2)
Lus10039207 57 / 7e-11 AT5G09250 125 / 1e-38 ssDNA-binding transcriptional regulator (.1.2)
Lus10032409 45 / 1e-06 AT5G42060 58 / 2e-12 DEK, chromatin associated protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G089400 135 / 3e-41 AT4G10920 152 / 5e-48 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Potri.002G171900 76 / 2e-16 AT4G00980 373 / 7e-125 zinc knuckle (CCHC-type) family protein (.1)
Potri.007G101100 55 / 3e-10 AT5G09250 115 / 7e-35 ssDNA-binding transcriptional regulator (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08766 DEK_C DEK C terminal domain
CL0609 sPC4_like PF02229 PC4 Transcriptional Coactivator p15 (PC4)
Representative CDS sequence
>Lus10023061 pacid=23170288 polypeptide=Lus10023061 locus=Lus10023061.g ID=Lus10023061.BGIv1.0 annot-version=v1.0
ATGGATTCCAAAACGAAGATCGACATCGAGAAAAGCGTACGCAGAATCATCGATGAATCCGACATGACCTCCACTACGGAGTCCCAGATTCGCAAGAGGG
CATCCCAGGAGCTGGGACTCGACCTCAATAAACCAGAGTTCAAGGCCTATGTCAGGCATGTCGTCAACAAATTTCTACAGGAAGCTGCTGAAAAGGAGCA
GGAAAAGGAAGAAGCAGAAGCTGATGATGGGGGTGAAGGTCAACAAGCTGCTGGTGGCGTGGAGTATGACGATGATGGTGATCTCATCATTTGCAGGTTG
ACGTCCAAGAGAAGGGTGACGATTCAGAATTTCAGAGGGAGGAACTTGGTGTCGATAAGGGAGTTCTACAGTAAAGATGGGAAAGAACTTCCAACTTCCA
AAGGTAGCTTCAAGCTTGATGTTTTTATCGTTTTATTGTCACTAGTCGTTCAGAAAAGGGATAATATTGATAAGGTGTCTACTGTCCAGTGTCCTAAGTG
A
AA sequence
>Lus10023061 pacid=23170288 polypeptide=Lus10023061 locus=Lus10023061.g ID=Lus10023061.BGIv1.0 annot-version=v1.0
MDSKTKIDIEKSVRRIIDESDMTSTTESQIRKRASQELGLDLNKPEFKAYVRHVVNKFLQEAAEKEQEKEEAEADDGGEGQQAAGGVEYDDDGDLIICRL
TSKRRVTIQNFRGRNLVSIREFYSKDGKELPTSKGSFKLDVFIVLLSLVVQKRDNIDKVSTVQCPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10920 KELP transcriptional coactivator p1... Lus10023061 0 1
AT4G22310 Uncharacterised protein family... Lus10011790 1.4 0.9360
AT5G55810 ATNMNAT nicotinate/nicotinamide mononu... Lus10023862 2.0 0.9338
AT2G43190 ribonuclease P family protein ... Lus10026483 2.0 0.9278
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10037421 2.4 0.9244
AT2G23940 Protein of unknown function (D... Lus10028450 3.3 0.9143
AT4G20330 Transcription initiation facto... Lus10002233 3.7 0.9228
AT4G04740 CPK23, ATCPK23 calcium-dependent protein kina... Lus10022624 3.9 0.9293
AT5G27830 unknown protein Lus10020660 4.9 0.9023
AT3G61113 Ubiquitin related modifier 1 (... Lus10041378 5.7 0.9228
AT5G63080 2-oxoglutarate (2OG) and Fe(II... Lus10001249 6.3 0.9179

Lus10023061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.