Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023083 [exp] 114 / 1e-33 ND 36 / 0.005 Lus10032385 [exp] 107 / 4e-31 ND 39 / 1e-04 Lus10001828 [exp] 66 / 8e-15 ND 35 / 0.003 Lus10003883 [exp] 65 / 1e-14 ND / Lus10003882 [exp] 57 / 1e-11 ND 35 / 0.004
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G091500 [exp] 57 / 2e-11 AT1G64405 42 / 5e-06 unknown protein Potri.003G140100 [exp] 56 / 2e-11 AT1G64405 42 / 5e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023082 pacid=23170388 polypeptide=Lus10023082 locus=Lus10023082.g ID=Lus10023082.BGIv1.0 annot-version=v1.0 ATGGGAAATTGCTTACAAAGAAACAAGCTAAGCGGCCAAGTGGAAGAAGAAGAAGAAGACATTAATGTTAAGCCGGCGCCTGTGAATGGGAAGAAAGTGA AGATAGTACTGAGCAAGGAGGAGCTGGAGTGGCTGATGTTCGAGCTCAAAAACGGAGGAACCACCAAGAAGATTGAAGATGCTCTGGCGGAGATCCAAAG AAACAGAGGATCACCTCTCAAACCAGTTAATGTTGTTTTCGATGTCGACGAGGACGAGGATTATGATGATGATGATAGTAATTGGCGGCCTTCTTTGGAC AGCATTCTTGAAGAAGAAGAAGAAGAAGAATCCGAAAGATCATGA
AA sequence Show only first row Show all	>Lus10023082 pacid=23170388 polypeptide=Lus10023082 locus=Lus10023082.g ID=Lus10023082.BGIv1.0 annot-version=v1.0 MGNCLQRNKLSGQVEEEEEDINVKPAPVNGKKVKIVLSKEELEWLMFELKNGGTTKKIEDALAEIQRNRGSPLKPVNVVFDVDEDEDYDDDDSNWRPSLD SILEEEEEEESERS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023082 [exp]	0	1
AT1G01490			Heavy metal transport/detoxifi...		Lus10039285 [exp]	2.2	0.8126
AT1G01490			Heavy metal transport/detoxifi...		Lus10027522 [exp]	4.0	0.8688
					Lus10041663 [exp]	4.7	0.8606
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Lus10039771 [exp]	7.1	0.8385
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020491 [exp]	8.7	0.8164
AT1G10340			Ankyrin repeat family protein ...		Lus10038609 [exp]	12.7	0.8122
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10037226 [exp]	14.4	0.8016
AT3G54040			PAR1 protein (.1)		Lus10017196 [exp]	15.8	0.7765
AT5G53110			RING/U-box superfamily protein...		Lus10004756 [exp]	19.3	0.8041
AT1G13110		CYP71B7	"cytochrome P450, family 71 su...		Lus10042815 [exp]	21.6	0.7905

Compare expression of checked genes

Lus10023082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.