Lus10023083 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032385 159 / 8e-51 ND 39 / 1e-04
Lus10023082 127 / 1e-38 ND /
Lus10001828 79 / 1e-19 ND 35 / 0.003
Lus10003883 76 / 2e-18 ND /
Lus10003882 65 / 2e-14 ND 35 / 0.004
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G140100 59 / 4e-12 AT1G64405 42 / 5e-06 unknown protein
Potri.001G091500 56 / 6e-11 AT1G64405 42 / 5e-06 unknown protein
PFAM info
Representative CDS sequence
>Lus10023083 pacid=23170298 polypeptide=Lus10023083 locus=Lus10023083.g ID=Lus10023083.BGIv1.0 annot-version=v1.0
ATGGGAAATTGCTTACAGAGAAACAAACTAATGAGCCAAGTGCACCAAGCTGAAGAAGAAGACACTGTCAGCAAGCATTCATGTGACTACTTGAAGGAGG
AGATCAAGGAAGAAGAGAAACCTGCATCTGTTAATGGGAAGAAAGTGAAGATAGTACTGAGCAAGGAGGAGCTGGACTGGCTGATGTTGGAGCTCAACAA
TGGAGGATCCGCGAAGAAGATTGAAGATGCTCTGGCTGAGATCCAGAGAAGCAGAGGATCGCCTCTCAAACCAGTTAATGTTGTTTTTGATTTGGACGAC
GAGGGTGATGAGGATTATGAGGATGAGGATGATGATGAGAGTAGTAATTGCTGGCGGCCTTCTTTGGACAGCATCCCTGAAGAAGAAGAAGAAGAAGAAG
AAGAAGAATCTGAGAGATGA
AA sequence
>Lus10023083 pacid=23170298 polypeptide=Lus10023083 locus=Lus10023083.g ID=Lus10023083.BGIv1.0 annot-version=v1.0
MGNCLQRNKLMSQVHQAEEEDTVSKHSCDYLKEEIKEEEKPASVNGKKVKIVLSKEELDWLMLELNNGGSAKKIEDALAEIQRSRGSPLKPVNVVFDLDD
EGDEDYEDEDDDESSNCWRPSLDSIPEEEEEEEEEESER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10023083 0 1
AT3G29000 Calcium-binding EF-hand family... Lus10019090 7.9 0.7656
AT4G19540 INDH, INDL IND1(iron-sulfur protein requi... Lus10024867 11.1 0.7409
AT2G15580 RING/U-box superfamily protein... Lus10001688 13.0 0.7292
AT1G76390 PUB43 plant U-box 43, ARM repeat sup... Lus10030734 18.5 0.7212
AT1G54340 ICDH isocitrate dehydrogenase (.1) Lus10010431 46.2 0.7149
AT2G27830 unknown protein Lus10006996 61.8 0.7043
AT4G27130 Translation initiation factor ... Lus10031550 65.7 0.7057
AT1G14860 ATNUDT18 nudix hydrolase homolog 18 (.1... Lus10003713 70.8 0.7005
AT1G14140 Mitochondrial substrate carrie... Lus10030443 74.7 0.7056
AT3G60540 Preprotein translocase Sec, Se... Lus10025029 82.8 0.7052

Lus10023083 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.