Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) AT4G16195 52 / 5e-09 Plant self-incompatibility protein S1 family (.1) AT3G17080 49 / 5e-08 Plant self-incompatibility protein S1 family (.1) AT2G06090 45 / 9e-07 Plant self-incompatibility protein S1 family (.1) AT1G11765 45 / 1e-06 Plant self-incompatibility protein S1 family (.1) AT5G12070 44 / 3e-06 Plant self-incompatibility protein S1 family (.1) AT1G04645 42 / 8e-06 Plant self-incompatibility protein S1 family (.1) AT5G04347 41 / 3e-05 Plant self-incompatibility protein S1 family (.1) AT3G26880 40 / 4e-05 Plant self-incompatibility protein S1 family (.1) AT3G16970 37 / 0.001 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032383 [exp] 110 / 1e-32 AT4G24975 40 / 5e-05 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 80 / 2e-20 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10023195 [exp] 80 / 3e-20 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10019767 [exp] 79 / 9e-20 AT4G29035 50 / 1e-08 Plant self-incompatibility protein S1 family (.1) Lus10019768 [exp] 73 / 2e-17 AT4G16195 50 / 2e-08 Plant self-incompatibility protein S1 family (.1) Lus10023196 [exp] 72 / 5e-17 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1) Lus10023194 [exp] 72 / 8e-17 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 72 / 9e-17 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 71 / 2e-16 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G008300 [exp] 55 / 2e-10 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.016G066900 [exp] 53 / 2e-09 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 49 / 6e-08 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.004G199700 [exp] 42 / 2e-05 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.006G170200 [exp] 40 / 6e-05 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 40 / 9e-05 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.017G144361 [exp] 39 / 0.0002 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 37 / 0.0007 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 37 / 0.0007 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10023085 pacid=23170328 polypeptide=Lus10023085 locus=Lus10023085.g ID=Lus10023085.BGIv1.0 annot-version=v1.0 ATGAAGAAGGTGGCCTACGCAACGCTAATGCTACTACTGATCATCATGGGTGCAGCACGACCGTCGCAGCAGTCGACTGATACGATGGTCAGGATTACGA ATAGGCTCAACAAAGCAGTGATCGCTCATTGTCAATCCGGAGACGACGACTTCGGGGCCTTAACCCTTCTTCCCGGGGCTGAGTTTCACTGGAGCTTCGA GCCGGTGGGTTTCGGTATAACATTATACTGGTGTGACCTCGCCGTCGGCGACTGGCATCTCCATTTCGACGCCTACACCGAGGAGAGGCATTACGCACCG GTATGGGATATCGACGATAATGGGGTTACTCCCACTTACTTCAAATTTATTTCGTTTCCATGGACCAAAATTTGA
AA sequence Show only first row Show all	>Lus10023085 pacid=23170328 polypeptide=Lus10023085 locus=Lus10023085.g ID=Lus10023085.BGIv1.0 annot-version=v1.0 MKKVAYATLMLLLIIMGAARPSQQSTDTMVRITNRLNKAVIAHCQSGDDDFGALTLLPGAEFHWSFEPVGFGITLYWCDLAVGDWHLHFDAYTEERHYAP VWDIDDNGVTPTYFKFISFPWTKI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12060			Plant self-incompatibility pro...		Lus10023085 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006693 [exp]	1.4	1.0000
AT5G18460			Protein of Unknown Function (D...		Lus10006861 [exp]	2.0	1.0000
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	2.4	0.9472
AT5G03620			Subtilisin-like serine endopep...		Lus10003254 [exp]	2.6	0.9377
AT2G39730		RCA	rubisco activase (.1.2.3)		Lus10035616 [exp]	3.5	0.9888
AT2G17030			F-box family protein with a do...		Lus10022619 [exp]	3.9	0.9918
AT1G62310			transcription factor jumonji (...		Lus10004603 [exp]	4.0	0.9101
					Lus10011218 [exp]	5.0	0.9854
					Lus10028652 [exp]	5.2	0.8684
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027896 [exp]	5.3	0.8238

Compare expression of checked genes

Lus10023085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.