Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 64 / 3e-14 LTP3 lipid transfer protein 3 (.1) AT4G33355 62 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G59310 58 / 1e-11 LTP4 lipid transfer protein 4 (.1) AT2G18370 57 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38530 51 / 3e-09 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G01870 50 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 47 / 1e-07 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G08770 44 / 1e-06 LTP6 lipid transfer protein 6 (.1.2) AT3G51590 44 / 2e-06 LTP12 lipid transfer protein 12 (.1) AT3G51600 42 / 2e-05 LTP5 lipid transfer protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032381 [exp] 206 / 2e-66 AT5G62050 270 / 4e-87 HOMOLOG OF YEAST OXIDASE ASSEMBLY 1 \(OXA1\) IN ARABIDOPSIS THALIANA, ARABIDOPSIS THALIANA HOMOLOG OF YEAST OXIDASE ASSEMBLY 1 \(OXA1\), homolog of yeast oxidase assembly 1 (OXA1) (.1) Lus10001829 [exp] 129 / 1e-39 AT4G33355 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10003884 [exp] 129 / 3e-39 AT4G33355 72 / 6e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10007280 [exp] 69 / 4e-16 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10015279 [exp] 67 / 2e-15 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10015278 [exp] 67 / 4e-15 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10029226 [exp] 67 / 6e-15 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1) Lus10022745 [exp] 61 / 9e-13 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 61 / 1e-12 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 62 / 2e-13 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 60 / 2e-12 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.014G098000 [exp] 59 / 4e-12 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1) Potri.014G046500 [exp] 58 / 1e-11 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232900 [exp] 51 / 6e-09 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 50 / 8e-09 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 50 / 1e-08 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 49 / 3e-08 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 48 / 8e-08 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 45 / 7e-07 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10023087 pacid=23170319 polypeptide=Lus10023087 locus=Lus10023087.g ID=Lus10023087.BGIv1.0 annot-version=v1.0 ATGAGCCGCTACATGGCAGCTGTTTTCCTAGCCATCCTCCTCATCGCTAACGGCGATGCCCGGGTGGCTGCTCAGGAGCCGAAGCTAGCTCCTCCATCCT GTTCCGTGGTCTACAACGACTTGCAGCCGTGCATTCCTTATCTCTCCGGCGGCGGTGGACAAGCAGCTGCAGGGGTGGGTGAACCGACGAAGGAATGCTG CAGCGGAGTGAAGTCGCTTCAGCCGTACTCAGAGTCGAAATCGGATCGAGTTGCGTTGTGCCAGTGCTTCAAGTCGTTGGTTGGTTCAGTGCCTGGGATT GATCTGTCCGTTGCGTCTAATCTTCCGGGCAAATGTAACGTCAATGTCCACCTGCCTAAGCTCTCTCTCGACTTTGACTGTTCCAAGGCTTGA
AA sequence Show only first row Show all	>Lus10023087 pacid=23170319 polypeptide=Lus10023087 locus=Lus10023087.g ID=Lus10023087.BGIv1.0 annot-version=v1.0 MSRYMAAVFLAILLIANGDARVAAQEPKLAPPSCSVVYNDLQPCIPYLSGGGGQAAAGVGEPTKECCSGVKSLQPYSESKSDRVALCQCFKSLVGSVPGI DLSVASNLPGKCNVNVHLPKLSLDFDCSKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10023087 [exp]	0	1
AT2G40940		ERS1	ethylene response sensor 1 (.1...		Lus10013415 [exp]	4.7	0.8251
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Lus10016538 [exp]	5.9	0.8550
AT4G08980		FBW2	F-BOX WITH WD-40 2 (.1.2.3.4.5...		Lus10010351 [exp]	7.3	0.8020
AT5G11770			NADH-ubiquinone oxidoreductase...		Lus10032157 [exp]	15.7	0.8196
AT5G61030		GR-RBP3	glycine-rich RNA-binding prote...		Lus10021154 [exp]	17.7	0.8064
AT3G02510			Regulator of chromosome conden...		Lus10017581 [exp]	19.3	0.7874
AT4G10265			Wound-responsive family protei...		Lus10039754 [exp]	19.5	0.7849
AT3G20970		ATNFU2, NFU4	ARABIDOPSIS THALIANA NFU DOMAI...		Lus10043440 [exp]	20.8	0.7558
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Lus10037778 [exp]	21.2	0.7548
AT1G31830			Amino acid permease family pro...		Lus10012153 [exp]	23.5	0.8124

Compare expression of checked genes

Lus10023087 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.