Lus10023108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10023108 pacid=23170419 polypeptide=Lus10023108 locus=Lus10023108.g ID=Lus10023108.BGIv1.0 annot-version=v1.0
ATGTTGATGAAGGAAGTCTCTCCCTTGGCGCCGCTTCATATGAGCATTAACAAACATGCATCTTCTCATAAGGAATTTGCAATCCCTAACGTTGATGCAT
CAGATGCCCAGCTTGCCATGATTTCTTCTGGTCAAATTAATGAGCTAATTTCGGCGGTGTCAAAGTCAAGGCCTGAAGATGACAGAATAGCAAGTGAAGT
TGCTCCAGTGATAAAGATGTGTGTCTAA
AA sequence
>Lus10023108 pacid=23170419 polypeptide=Lus10023108 locus=Lus10023108.g ID=Lus10023108.BGIv1.0 annot-version=v1.0
MLMKEVSPLAPLHMSINKHASSHKEFAIPNVDASDAQLAMISSGQINELISAVSKSRPEDDRIASEVAPVIKMCV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10023108 0 1
Lus10000351 2.4 1.0000
Lus10002886 3.5 1.0000
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021543 4.2 1.0000
Lus10014748 4.9 1.0000
AT3G26880 Plant self-incompatibility pro... Lus10022631 5.5 1.0000
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10022782 6.0 1.0000
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10023249 7.0 1.0000
Lus10024321 7.5 1.0000
AT2G02850 ARPN plantacyanin (.1) Lus10028396 7.9 1.0000
AT2G46530 ARF ARF11 auxin response factor 11 (.1.2... Lus10030240 8.4 1.0000

Lus10023108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.