Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02205 87 / 3e-21 CER1 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) AT2G37700 84 / 3e-20 Fatty acid hydroxylase superfamily (.1.2) AT1G02190 82 / 2e-19 Fatty acid hydroxylase superfamily (.1.2) AT5G57800 47 / 2e-07 CER3, FLP1, YRE, WAX2 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011473 [exp] 126 / 8e-37 AT1G02205 310 / 7e-102 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Lus10011472 [exp] 115 / 1e-32 AT1G02205 303 / 5e-99 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Lus10019510 [exp] 93 / 2e-23 AT1G02205 763 / 0.0 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Lus10023110 [exp] 60 / 1e-11 AT1G02205 261 / 6e-81 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Lus10023210 [exp] 53 / 4e-09 AT5G57800 882 / 0.0 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1) Lus10008895 [exp] 52 / 9e-09 AT5G57800 885 / 0.0 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1) Lus10015499 [exp] 42 / 2e-05 AT5G57800 877 / 0.0 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1) Lus10019971 [exp] 42 / 3e-05 AT5G57800 879 / 0.0 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G152600 [exp] 90 / 2e-22 AT1G02205 788 / 0.0 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Potri.014G152900 [exp] 90 / 3e-22 AT1G02205 789 / 0.0 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Potri.014G152301 [exp] 88 / 1e-21 AT1G02205 790 / 0.0 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Potri.014G180300 [exp] 88 / 1e-21 AT1G02205 793 / 0.0 ECERIFERUM 1, Fatty acid hydroxylase superfamily (.1.2.3) Potri.006G177500 [exp] 59 / 3e-11 AT5G57800 890 / 0.0 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1) Potri.018G099400 [exp] 49 / 4e-08 AT5G57800 851 / 0.0 FACELESS POLLEN 1, ECERIFERUM 3, Fatty acid hydroxylase superfamily (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023109 pacid=23170336 polypeptide=Lus10023109 locus=Lus10023109.g ID=Lus10023109.BGIv1.0 annot-version=v1.0 ATGGAACTGCATCCTACGCTGCCCTCTTCGGCTTACATCTTCTTCCTTGATTTCATGAACAACTTGGGCCACTGCAACTTCCGCTCTTCCTTCGACTACT ACTTCCTTGTCGACGACAAACTCTCGACGACTACGACGAAAAGCAGCTCCTTCTTCTCTGCTCCTCTCAAGCTCCTTCTCTACACGCCTTCATTCCACTC GGTGCATCACACCAAGTTCCAGAAGAATTACAGTCTTTTCATGCCGTTTTACGATTACATTTATGGAACGATTGAGAGTGCTCGTGAAGAGAAGAAGGAG ATGAAGAATAACTAG
AA sequence Show only first row Show all	>Lus10023109 pacid=23170336 polypeptide=Lus10023109 locus=Lus10023109.g ID=Lus10023109.BGIv1.0 annot-version=v1.0 MELHPTLPSSAYIFFLDFMNNLGHCNFRSSFDYYFLVDDKLSTTTTKSSSFFSAPLKLLLYTPSFHSVHHTKFQKNYSLFMPFYDYIYGTIESAREEKKE MKNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10023109 [exp]	0	1
AT3G24750			unknown protein		Lus10025939 [exp]	8.2	0.9251
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	8.7	0.9236
AT2G17080			Arabidopsis protein of unknown...		Lus10014450 [exp]	9.6	0.9233
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10021135 [exp]	15.3	0.9100
					Lus10034649 [exp]	16.9	0.8877
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040733 [exp]	16.9	0.8795
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10038057 [exp]	17.8	0.9128
AT2G17080			Arabidopsis protein of unknown...		Lus10023963 [exp]	20.6	0.9046
AT2G17080			Arabidopsis protein of unknown...		Lus10025126 [exp]	20.7	0.9110
AT2G17080			Arabidopsis protein of unknown...		Lus10023965 [exp]	21.3	0.9099

Compare expression of checked genes

Lus10023109 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.