Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16000 88 / 2e-24 unknown protein AT1G80890 63 / 1e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011478 [exp] 104 / 7e-31 AT1G16000 125 / 3e-39 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G043300 [exp] 90 / 2e-25 AT1G16000 106 / 5e-32 unknown protein Potri.003G183501 [exp] 73 / 1e-18 AT1G16000 68 / 1e-16 unknown protein Potri.004G051201 [exp] 51 / 6e-10 AT1G16000 52 / 4e-10 unknown protein Potri.008G111650 [exp] 37 / 0.0001 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023116 pacid=23170272 polypeptide=Lus10023116 locus=Lus10023116.g ID=Lus10023116.BGIv1.0 annot-version=v1.0 ATGGGAAGTGAGTCGAAAACTGGCGGCGCCACCAATGGAGGAAGAGCGGAAGGGTTCAAGTCGAAGGTAGAGCATGCCTTGTACAGCGGGGAAAAGAAGT ATGTCATCGGCGGAATAGCTGTCATATCTGTGATCTTCGGCATCCCTTGGTACCTCATGAACAGAGGATCAAAGCATCAGTCGCATCAAGATTACATGGA CAAGGCTGACAAGGCCAGGAAGGCAAGACTTTCGTCTAGTTCATCTGCTACCTGA
AA sequence Show only first row Show all	>Lus10023116 pacid=23170272 polypeptide=Lus10023116 locus=Lus10023116.g ID=Lus10023116.BGIv1.0 annot-version=v1.0 MGSESKTGGATNGGRAEGFKSKVEHALYSGEKKYVIGGIAVISVIFGIPWYLMNRGSKHQSHQDYMDKADKARKARLSSSSSAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16000			unknown protein		Lus10023116 [exp]	0	1
AT2G03870		EMB2816	EMBRYO DEFECTIVE 2816, Small n...		Lus10035639 [exp]	1.4	0.8361
AT5G15220			Ribosomal protein L27 family p...		Lus10010822 [exp]	1.4	0.7687
AT2G37975			Yos1-like protein (.1)		Lus10017192 [exp]	9.9	0.7434
AT1G11760		MED32	unknown protein		Lus10033295 [exp]	10.6	0.7583
AT4G31460			Ribosomal L28 family (.1)		Lus10003683 [exp]	13.7	0.7206
AT2G43780			unknown protein		Lus10035718 [exp]	14.0	0.7494
AT2G20450			Ribosomal protein L14 (.1)		Lus10024918 [exp]	15.0	0.7645
AT5G46160			Ribosomal protein L14p/L23e fa...		Lus10023296 [exp]	20.6	0.7289
AT2G18196			Heavy metal transport/detoxifi...		Lus10010147 [exp]	27.3	0.7452
AT5G09900		RPN5A, MSA, EMB...	REGULATORY PARTICLE NON-ATPASE...		Lus10006797 [exp]	30.2	0.7068

Compare expression of checked genes

Lus10023116 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.