Lus10023127 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80100 178 / 5e-58 AHP6 histidine phosphotransfer protein 6 (.1.2)
AT5G39340 103 / 1e-28 ATHP2, AHP3 ARABIDOPSIS THALIANA HISTIDINE-CONTAINING PHOSPHOTRANSMITTER 2, histidine-containing phosphotransmitter 3 (.1)
AT1G03430 102 / 3e-28 AHP5 histidine-containing phosphotransfer factor 5 (.1)
AT3G21510 99 / 5e-27 ATHP3, AHP1 histidine-containing phosphotransmitter 1 (.1)
AT3G29350 98 / 2e-26 ATHP1, AHP2 histidine-containing phosphotransmitter 2 (.1.2)
AT3G16360 83 / 1e-20 AHP4 HPT phosphotransmitter 4 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011487 259 / 2e-89 AT1G80100 194 / 6e-64 histidine phosphotransfer protein 6 (.1.2)
Lus10033999 111 / 1e-31 AT3G21510 216 / 3e-73 histidine-containing phosphotransmitter 1 (.1)
Lus10012777 110 / 2e-31 AT3G21510 216 / 5e-73 histidine-containing phosphotransmitter 1 (.1)
Lus10000926 88 / 1e-22 AT3G21510 181 / 3e-59 histidine-containing phosphotransmitter 1 (.1)
Lus10038280 83 / 9e-21 AT3G16360 225 / 4e-77 HPT phosphotransmitter 4 (.1.2)
Lus10025821 82 / 4e-20 AT3G16360 226 / 4e-77 HPT phosphotransmitter 4 (.1.2)
Lus10035596 77 / 2e-18 AT3G16360 103 / 5e-29 HPT phosphotransmitter 4 (.1.2)
Lus10002256 77 / 2e-18 AT3G21510 154 / 3e-49 histidine-containing phosphotransmitter 1 (.1)
Lus10003256 77 / 4e-18 AT1G03430 105 / 1e-29 histidine-containing phosphotransfer factor 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G032400 195 / 8e-65 AT1G80100 204 / 2e-68 histidine phosphotransfer protein 6 (.1.2)
Potri.001G191900 195 / 1e-64 AT1G80100 204 / 2e-68 histidine phosphotransfer protein 6 (.1.2)
Potri.010G027100 110 / 2e-31 AT3G21510 206 / 5e-69 histidine-containing phosphotransmitter 1 (.1)
Potri.013G028300 108 / 8e-31 AT3G21510 183 / 2e-60 histidine-containing phosphotransmitter 1 (.1)
Potri.008G197600 108 / 8e-31 AT3G21510 193 / 3e-64 histidine-containing phosphotransmitter 1 (.1)
Potri.006G098200 108 / 8e-31 AT1G03430 207 / 7e-70 histidine-containing phosphotransfer factor 5 (.1)
Potri.016G113500 107 / 3e-30 AT1G03430 210 / 1e-70 histidine-containing phosphotransfer factor 5 (.1)
Potri.005G040400 104 / 3e-29 AT3G21510 181 / 1e-59 histidine-containing phosphotransmitter 1 (.1)
Potri.014G136200 104 / 3e-29 AT1G03430 163 / 2e-52 histidine-containing phosphotransfer factor 5 (.1)
Potri.001G189900 86 / 6e-22 AT3G16360 239 / 1e-82 HPT phosphotransmitter 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01627 Hpt Hpt domain
Representative CDS sequence
>Lus10023127 pacid=23170390 polypeptide=Lus10023127 locus=Lus10023127.g ID=Lus10023127.BGIv1.0 annot-version=v1.0
ATGAACCGTTTACTCTCCCTCCTCTTCCACCAGGGAGTGTTGGACGAGCAGTTCTTGCAGCTGCAGCAGCTCGAAGATGAGAGCTCCCCGAACTTCGTAT
CGGAAGTAGTCAACATCTACTTCCATGAGTCCGAGAAGCTCCTCACTTCCCTCCGCCGACTTCTAATGAAGGGGGAGGAATCGGAGGGGTGTGAATATGG
GAAGATAGGGATACACTTGAATCAGTTTATGGGGAGTAGCTCAAGCATCGGTGCTAAGAGGGTGAGGAATGTTTGCCTCGCTTTTCGGTCAGCTTCTGAC
CGGACCAATAGACACGGGTGTTTGAGAGCTCTAGAGGTGTTGGAGCATGAGTACTGCTACCTCAAGAACAAGCTGCATGAACTCTTCCAATTAGAGCAGC
AGAGAGTGCTGGCAGCTGGAGTTAGGTACCCAATGCAGCACCATCACCAGAACATCCACAACAACATCAATAGCTAA
AA sequence
>Lus10023127 pacid=23170390 polypeptide=Lus10023127 locus=Lus10023127.g ID=Lus10023127.BGIv1.0 annot-version=v1.0
MNRLLSLLFHQGVLDEQFLQLQQLEDESSPNFVSEVVNIYFHESEKLLTSLRRLLMKGEESEGCEYGKIGIHLNQFMGSSSSIGAKRVRNVCLAFRSASD
RTNRHGCLRALEVLEHEYCYLKNKLHELFQLEQQRVLAAGVRYPMQHHHQNIHNNINS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80100 AHP6 histidine phosphotransfer prot... Lus10023127 0 1
AT4G14640 CAM8, AtCML8 calmodulin-like 8, calmodulin ... Lus10004088 2.8 0.8900
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Lus10012478 2.8 0.8637
AT2G45750 S-adenosyl-L-methionine-depend... Lus10005764 6.3 0.8689
AT5G08630 DDT domain-containing protein ... Lus10004282 6.8 0.8814
AT1G65680 ATHEXPBETA1.4, ... expansin B2 (.1) Lus10038933 11.6 0.8119
AT3G21330 bHLH bHLH087 basic helix-loop-helix (bHLH) ... Lus10003500 13.4 0.8046
AT3G04570 AT-hook AHL19 AT-hook motif nuclear-localize... Lus10006577 16.0 0.8747
AT4G01240 S-adenosyl-L-methionine-depend... Lus10035135 20.7 0.8661
AT4G22000 unknown protein Lus10008487 23.4 0.8649
AT1G66540 Cytochrome P450 superfamily pr... Lus10032856 27.7 0.8642

Lus10023127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.