Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59470 92 / 1e-24 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) AT3G07500 45 / 4e-07 FAR1_related Far-red impaired responsive (FAR1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G029100 [exp] 97 / 1e-26 AT3G59470 323 / 1e-112 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) Potri.007G129500 [exp] 95 / 8e-26 AT3G59470 260 / 9e-88 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) Potri.008G076800 [exp] 44 / 1e-06 AT3G59470 156 / 1e-46 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2) Potri.007G128900 [exp] 44 / 2e-06 AT3G07500 154 / 2e-46 Far-red impaired responsive (FAR1) family protein (.1) Potri.002G239300 [exp] 38 / 0.0001 AT2G43280 130 / 2e-37 Far-red impaired responsive (FAR1) family protein (.1) Potri.002G239400 [exp] 38 / 0.0001 AT4G12850 207 / 1e-68 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3) Potri.014G176600 [exp] 37 / 0.0003 AT4G12850 178 / 5e-57 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023134 pacid=23170429 polypeptide=Lus10023134 locus=Lus10023134.g ID=Lus10023134.BGIv1.0 annot-version=v1.0 ATGTCCTGTCCGGTTCGGACAACCTTGCAGAATGAACACGATAAGATACGGGAGCTGTCGCAGCAGTTAGCAGCGGAGAAGAAGAGAGCTGCGACCTACA AGAGGCACCTGGAATTGATATTTGAACAGATTGAAGAACAGAATCAGTCTCTGTCCAACAAAATCCGCCACATTGTTCAAAGTGTGAGGGACATAGATCG CGAGGATCAGCAGCAGCATTAG
AA sequence Show only first row Show all	>Lus10023134 pacid=23170429 polypeptide=Lus10023134 locus=Lus10023134.g ID=Lus10023134.BGIv1.0 annot-version=v1.0 MSCPVRTTLQNEHDKIRELSQQLAAEKKRAATYKRHLELIFEQIEEQNQSLSNKIRHIVQSVRDIDREDQQQH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10023134 [exp]	0	1
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Lus10042895 [exp]	10.9	0.8515
AT4G38495			unknown protein		Lus10029400 [exp]	12.4	0.8032
AT1G14990			unknown protein		Lus10035021 [exp]	18.2	0.7559
AT3G47160			RING/U-box superfamily protein...		Lus10001209 [exp]	20.1	0.8475
AT4G33540			metallo-beta-lactamase family ...		Lus10008550 [exp]	22.8	0.8258
AT5G10860		CBSX3	CBS domain containing protein ...		Lus10019117 [exp]	23.7	0.8393
AT3G52230			unknown protein		Lus10038643 [exp]	25.9	0.8099
AT1G73350			unknown protein		Lus10031897 [exp]	26.7	0.8317
AT3G05675			BTB/POZ domain-containing prot...		Lus10021269 [exp]	28.3	0.7813
AT3G32930			unknown protein		Lus10039189 [exp]	28.4	0.7900

Compare expression of checked genes

Lus10023134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.