Lus10023135 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80230 82 / 7e-21 Rubredoxin-like superfamily protein (.1)
AT3G15640 61 / 1e-12 Rubredoxin-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035917 130 / 1e-39 AT1G80230 187 / 2e-61 Rubredoxin-like superfamily protein (.1)
Lus10025745 85 / 6e-22 AT1G80230 161 / 3e-51 Rubredoxin-like superfamily protein (.1)
Lus10011494 80 / 1e-20 AT1G80230 148 / 5e-47 Rubredoxin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G173800 81 / 4e-20 AT1G80230 162 / 2e-51 Rubredoxin-like superfamily protein (.1)
Potri.003G060100 76 / 3e-18 AT1G80230 167 / 2e-53 Rubredoxin-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10023135 pacid=23170309 polypeptide=Lus10023135 locus=Lus10023135.g ID=Lus10023135.BGIv1.0 annot-version=v1.0
ATGTGGAGAAGAACAGTTTGTTCACAGATCAAAACCCTAGCCGCCGCCCGAGGCGCTGCCTCCTCATCTTTCTCATCCCGATTGCCCAATGTTCACAGAT
CCCTCGTTTCTGCGGCAGCACCTTCCTCGCTATTCAACCGCTATTTTAGTGCCGGAGCAGATGGAGCATTGAAAAAGCCTGAGGATGTAATGCCTATTGC
CACTGGACATGAACGTGAAGAACTTGAAGCTGAATTGCAGGGAAAGGATATTCTTGACATGAACTATCCCGTTGGTCCATTTGGCACAAAGTTGGAGGTT
GAGGGCCCTGGAGGAGACCCTGAAGCTGGACATGGCGATCACTAA
AA sequence
>Lus10023135 pacid=23170309 polypeptide=Lus10023135 locus=Lus10023135.g ID=Lus10023135.BGIv1.0 annot-version=v1.0
MWRRTVCSQIKTLAAARGAASSSFSSRLPNVHRSLVSAAAPSSLFNRYFSAGADGALKKPEDVMPIATGHEREELEAELQGKDILDMNYPVGPFGTKLEV
EGPGGDPEAGHGDH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80230 Rubredoxin-like superfamily pr... Lus10023135 0 1
AT1G54220 Dihydrolipoamide acetyltransfe... Lus10037617 1.7 0.8479
AT3G14300 ATPMEPCRC, ATPM... A. THALIANA PECTIN METHYLESTER... Lus10003934 14.0 0.7910
AT2G37250 ADK, ATPADK1 adenosine kinase (.1) Lus10040358 17.5 0.7662
AT2G16595 Translocon-associated protein ... Lus10012169 19.4 0.7700
AT4G38510 ATPase, V1 complex, subunit B ... Lus10027827 19.8 0.7769
AT4G32410 AtCESA1, RSW1, ... RADIALLY SWOLLEN 1, cellulose ... Lus10028597 22.4 0.7782
AT4G38510 ATPase, V1 complex, subunit B ... Lus10005057 29.8 0.7713
AT3G02090 MPPBETA Insulinase (Peptidase family M... Lus10004939 31.5 0.7668
AT5G19760 Mitochondrial substrate carrie... Lus10030361 32.9 0.7697
AT1G51540 Galactose oxidase/kelch repeat... Lus10034826 47.2 0.7681

Lus10023135 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.