Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05260 91 / 2e-21 CYP79A2 cytochrome p450 79a2 (.1) AT5G35917 90 / 6e-21 CYP79A3P "cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene", cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene (.1) AT2G22330 85 / 3e-19 CYP79B3 "cytochrome P450, family 79, subfamily B, polypeptide 3", cytochrome P450, family 79, subfamily B, polypeptide 3 (.1) AT1G58260 69 / 1e-13 CYP79C3P, CYP79C2 cytochrome p450 79c2 (.1) AT1G79370 65 / 3e-12 CYP79C1 "cytochrome P450, family 79, subfamily C, polypeptide 1", cytochrome P450, family 79, subfamily C, polypeptide 1 (.1) AT1G16400 57 / 1e-09 CYP79F2 "cytochrome P450, family 79, subfamily F, polypeptide 2", cytochrome P450, family 79, subfamily F, polypeptide 2 (.1) AT1G16410 54 / 9e-09 SPS1, BUS1, CYP79F1 SUPERSHOOT 1, BUSHY 1, cytochrome p450 79f1 (.1.2) AT5G67310 41 / 0.0004 CYP81G1 "cytochrome P450, family 81, subfamily G, polypeptide 1", cytochrome P450, family 81, subfamily G, polypeptide 1 (.1) AT5G07990 40 / 0.0008 CYP75B1, D501, TT7 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) AT4G39950 0 / 1 CYP79B2 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000239 [exp] 153 / 4e-45 AT2G22330 331 / 7e-110 "cytochrome P450, family 79, subfamily B, polypeptide 3", cytochrome P450, family 79, subfamily B, polypeptide 3 (.1) Lus10023144 [exp] 148 / 6e-42 AT4G39950 604 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031151 [exp] 110 / 4e-28 AT4G39950 603 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031727 [exp] 106 / 3e-27 AT5G35917 216 / 2e-65 "cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene", cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene (.1) Lus10018717 [exp] 40 / 0.0005 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10031145 [exp] 0 / 1 AT4G39950 561 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031726 [exp] 0 / 1 AT4G39950 573 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10023143 [exp] 0 / 1 AT4G39950 605 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10026341 [exp] 0 / 1 AT4G39950 563 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G157200 [exp] 92 / 2e-21 AT4G39950 580 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Potri.004G055200 [exp] 89 / 1e-20 AT4G39950 590 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Potri.013G157400 [exp] 87 / 9e-20 AT4G39950 556 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Potri.009G123600 [exp] 44 / 5e-05 AT4G36220 672 / 0.0 ferulic acid 5-hydroxylase 1 (.1) Potri.002G121100 [exp] 42 / 0.0001 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10023141 pacid=23170433 polypeptide=Lus10023141 locus=Lus10023141.g ID=Lus10023141.BGIv1.0 annot-version=v1.0 ATGGGTACTAGTGCTAACGCCTCTAAAGGAGCAGGTAGCATTATTGACAATGCTAAGAATCTCAAGCCGATGCTCCCTCCAAGCCCGCCATCCTGGCCGG TGGTCGGGAACATTCCGGAGCTCTTGATGAAAAAGCCGTGGTTTCGTTGGGTGCACCAGCTGATGAAGGAGATGAACACGGACATCTGCCTGATCCGCCT GGGCGGGTTCAACCTTATACCCGTATTGGACCCTGCCATTGCCAGGGAGTTCCTGAAGAAGCAGGACGCCATCTTCGCGGACCGACCCCACCAGGTGGGC AGCCATGCCATGAGCGGACGCTACCTAGACACTGACCACGATAGCCACGCCTTACAACGACCAGTGGCGCAAGATGAGGAAGGTGATGACCTCAGAGATA GTCTCCCCGGCCCGACTCAAGTGGCTCCACCAGAAGCGTGTCGAGGAGGCCAACAACCTGGTGTTCTACGTCCACAACCAAAGCATGGCTGGCAAGAGCG TCGACCTGAGGGTGGCCACCCAACATTACTGCGGGAACGTGATAAGGAAGATGATGTTCAGCAGGAGGTTCTTCGGCGAGCCAACCCTCGACGGTGGGCC CGGTCCTAA
AA sequence Show only first row Show all	>Lus10023141 pacid=23170433 polypeptide=Lus10023141 locus=Lus10023141.g ID=Lus10023141.BGIv1.0 annot-version=v1.0 MGTSANASKGAGSIIDNAKNLKPMLPPSPPSWPVVGNIPELLMKKPWFRWVHQLMKEMNTDICLIRLGGFNLIPVLDPAIAREFLKKQDAIFADRPHQVG SHAMSGRYLDTDHDSHALQRPVAQDEEGDDLRDSLPGPTQVAPPEACRGGQQPGVLRPQPKHGWQERRPEGGHPTLLRERDKEDDVQQEVLRRANPRRWA RS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05260		CYP79A2	cytochrome p450 79a2 (.1)		Lus10023141 [exp]	0	1
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10023143 [exp]	1.0	0.9586
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10023142 [exp]	1.4	0.9458
AT3G13480			unknown protein		Lus10010318 [exp]	13.7	0.7349
AT1G70780			unknown protein		Lus10035084 [exp]	19.7	0.7154
					Lus10002646 [exp]	23.9	0.6832
AT3G21870		CYCP2;1	cyclin p2;1 (.1)		Lus10027148 [exp]	26.3	0.7550
AT3G63540			Mog1/PsbP/DUF1795-like photosy...		Lus10016419 [exp]	28.4	0.7640
AT5G28150			Plant protein of unknown funct...		Lus10042600 [exp]	42.5	0.7028
AT4G22250			RING/U-box superfamily protein...		Lus10035335 [exp]	45.3	0.7286
AT5G46720			AIG2-like (avirulence induced ...		Lus10034712 [exp]	45.9	0.7311

Compare expression of checked genes

Lus10023141 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.