Lus10023160 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52820 244 / 9e-81 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 204 / 4e-65 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52800 187 / 2e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52790 184 / 3e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 169 / 2e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 165 / 1e-49 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 131 / 5e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 127 / 4e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03050 114 / 1e-30 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G23340 91 / 2e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016659 272 / 1e-91 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024 241 / 2e-79 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005516 178 / 3e-54 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006575 172 / 2e-53 AT1G52820 221 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008097 161 / 4e-48 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10013132 150 / 6e-44 AT1G52800 222 / 8e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041281 140 / 8e-41 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10013130 130 / 2e-36 AT1G52820 200 / 3e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021025 125 / 2e-34 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176200 251 / 2e-83 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800 208 / 1e-66 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900 201 / 1e-63 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176500 189 / 5e-59 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176000 186 / 8e-58 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000 170 / 2e-51 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G033400 165 / 9e-50 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100 144 / 1e-41 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G106900 103 / 6e-26 AT4G23340 392 / 1e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.003G128100 97 / 1e-23 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10023160 pacid=23170304 polypeptide=Lus10023160 locus=Lus10023160.g ID=Lus10023160.BGIv1.0 annot-version=v1.0
ATGGGAGAAGCTCCCCACATTCCGCTCCCGTTGTATGAGAGCGTCGGGATTGGTAGCCCTCATGTTCACGAAAAGGTCGAAGAGTTCGCCAATATACTTT
GGCCTCAAGGACATCCAAAGTTTAGCAAGTCGGTCCAGTTCTACGCGGAGCAAATCGTGGGGCTGGACGAAACAGTGAGAAGAATGGTGTTGGAGAGCTT
TGGGCTGGACAAGTTCATCGACGAGCACTTGGACTCCACAGAGTACTTGCTGAGGGTGATGAAATACAGAGCTCCGAAAACGAGCGATGAACAGGACGCC
ATGCTTCCGCATACCGACAAAGGATTCATGACGATACTGCACCCGAACGATGTTTCGGGATTGGGAATCCAGACCAAAGAAGGAGAATGGATCGAGTTCA
ATCGATCTCCCAACACTTACCTCGTTATGATGGCTGATTGCTTCTACGCTTGGTTGAATGGTCGAATCAAAGGTGCGATGCATCGGGTTAAGCTAAGTGG
AGACGAGCCCAGATACTCGATGGGTTTGTTCACTGTCCCGAAGCCCGGAGTTACAATCCAAGCCGCAGAAGGAATGGTGGACGAAGAGCATCCTCAGCTG
TTCAAGCCGTATAAGTTGGCTGAGTTCCTTGTGTATTATGACACCAAAGCTGGCCAGACATCGCCAACTCCTCTCAAAGATTACTGCGGCACCGGGGTTT
GA
AA sequence
>Lus10023160 pacid=23170304 polypeptide=Lus10023160 locus=Lus10023160.g ID=Lus10023160.BGIv1.0 annot-version=v1.0
MGEAPHIPLPLYESVGIGSPHVHEKVEEFANILWPQGHPKFSKSVQFYAEQIVGLDETVRRMVLESFGLDKFIDEHLDSTEYLLRVMKYRAPKTSDEQDA
MLPHTDKGFMTILHPNDVSGLGIQTKEGEWIEFNRSPNTYLVMMADCFYAWLNGRIKGAMHRVKLSGDEPRYSMGLFTVPKPGVTIQAAEGMVDEEHPQL
FKPYKLAEFLVYYDTKAGQTSPTPLKDYCGTGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Lus10023160 0 1
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10033385 1.0 0.9570
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006700 2.8 0.9323
AT5G04220 SYT3, NTMCTYPE1... synaptotagmin 3, Calcium-depen... Lus10009226 2.8 0.9000
AT2G43820 SGT1, ATSAGT1, ... UDP-glucose:salicylic acid glu... Lus10017826 3.0 0.9225
Lus10033191 9.5 0.8692
AT4G10250 ATHSP22.0 HSP20-like chaperones superfam... Lus10000932 11.2 0.8654
AT1G52560 HSP20-like chaperones superfam... Lus10024225 12.2 0.8837
Lus10028940 13.7 0.8578
AT1G52560 HSP20-like chaperones superfam... Lus10023653 14.2 0.8779
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10003459 14.9 0.8352

Lus10023160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.