Lus10023168 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09650 256 / 1e-80 CRM3, HCF152 HIGH CHLOROPHYLL FLUORESCENCE 152, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G69290 62 / 7e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G06920 59 / 6e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G68980 57 / 2e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G03100 54 / 3e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G18940 51 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G18475 51 / 2e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63630 49 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G62720 51 / 3e-07 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT2G17140 51 / 3e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015059 314 / 5e-102 AT3G09650 969 / 0.0 HIGH CHLOROPHYLL FLUORESCENCE 152, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10037077 62 / 6e-11 AT1G69290 827 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042362 57 / 4e-09 AT1G02420 613 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10043417 54 / 3e-08 AT3G06920 1358 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028942 49 / 5e-08 AT5G01110 118 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10026306 52 / 8e-08 AT1G02420 522 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020775 51 / 2e-07 AT1G03100 961 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031423 51 / 2e-07 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009201 51 / 2e-07 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G085300 266 / 2e-84 AT3G09650 961 / 0.0 HIGH CHLOROPHYLL FLUORESCENCE 152, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G095800 67 / 2e-12 AT1G69290 860 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G014100 57 / 2e-09 AT3G06920 1404 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G212400 56 / 7e-09 AT1G03100 1044 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G045000 55 / 1e-08 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.008G108300 54 / 3e-08 AT3G16890 771 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1)
Potri.017G091600 53 / 6e-08 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G150100 52 / 2e-07 AT1G62930 442 / 8e-149 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G176100 51 / 2e-07 AT3G49730 783 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G105600 51 / 3e-07 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10023168 pacid=23170278 polypeptide=Lus10023168 locus=Lus10023168.g ID=Lus10023168.BGIv1.0 annot-version=v1.0
ATGCTGAAAGATTCGCGGGTCAAAGTTGATTTGATTGCCTGGAATATGTTAGTTGAAGGGTATTGTAAGTTGGGTTTGGTTCAGGAAGCGAAGAGAGTTG
TAGAGAAGATGAAGGAGAATGGGTTTTACCATGATGTGGCTACTTATGGAAGTCTAGCAAATGGAATAGCATTGGCTAAAAAACCAGGGGAAGCTCTTCT
GTTATGGAAGGAAGTAAAAGATAGATGCGAGATGAAATGGAAAGGAGAGAGCTCCGAGTCCGACCCTGATTCGCCTCCTGTCCCACCTTTGAGGCCCGAT
GACGAGCTGTTAGATACACTGGCTGATATCTGCGTCAGAGGTGCTTTCTTCCAGAAGGCTTTGGAGATCGTTGCCTGCATGGAAGAATATAGAATTCCAC
CAAACAAGTCAAAGTACAAGAAGATTTATGTGGAGATGCATTCCAGGATGTTTACCAGTAAACATGCGTCGCAAGCGAGGCAAGATCGGAGGAAAGAGAG
GAAGAGAGCAGCCGAGGCTTTCAAGTTTTGGTTAGGTTTGCCTAATGAATATTATGGAAGCGAATGGCGACTCGATCCCTTGGACACCGAGATGGATGTC
AGCACAAAGGGATTAGAGAGGCTGGCAGGAACAGTTGTTTTGCAAGCAAATGCAGCAATAGTCCTTGTATGCAAACACAAAGAACTTGATCGAACTTACG
AGTAG
AA sequence
>Lus10023168 pacid=23170278 polypeptide=Lus10023168 locus=Lus10023168.g ID=Lus10023168.BGIv1.0 annot-version=v1.0
MLKDSRVKVDLIAWNMLVEGYCKLGLVQEAKRVVEKMKENGFYHDVATYGSLANGIALAKKPGEALLLWKEVKDRCEMKWKGESSESDPDSPPVPPLRPD
DELLDTLADICVRGAFFQKALEIVACMEEYRIPPNKSKYKKIYVEMHSRMFTSKHASQARQDRRKERKRAAEAFKFWLGLPNEYYGSEWRLDPLDTEMDV
STKGLERLAGTVVLQANAAIVLVCKHKELDRTYE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09650 CRM3, HCF152 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10023168 0 1
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000036 1.7 0.9267
AT2G38270 ATGRX2, CXIP2 GLUTAREDOXIN, CAX-interacting ... Lus10002847 3.2 0.9148
AT1G17100 SOUL heme-binding family prote... Lus10041532 4.2 0.9108
AT5G19020 MEF18 mitochondrial editing factor ... Lus10034022 5.3 0.8597
AT5G44000 Glutathione S-transferase fami... Lus10027233 5.3 0.8796
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000035 5.3 0.9088
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10010909 7.5 0.8947
AT1G58210 EMB1674 EMBRYO DEFECTIVE 1674, kinase ... Lus10001866 8.2 0.8763
AT5G16710 DHAR3 dehydroascorbate reductase 1 (... Lus10009135 9.8 0.8826
AT1G20340 PETE2, DRT112 PLASTOCYANIN 2, DNA-DAMAGE-REP... Lus10034554 10.5 0.9008

Lus10023168 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.