Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09730 75 / 4e-17 unknown protein AT4G31805 42 / 2e-05 WRKY family transcription factor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015071 [exp] 166 / 1e-51 AT3G09730 149 / 5e-41 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G130600 [exp] 91 / 1e-22 AT3G09730 212 / 8e-65 unknown protein Potri.018G019400 [exp] 40 / 7e-05 AT4G31805 84 / 8e-18 WRKY family transcription factor (.1) Potri.006G263800 [exp] 39 / 0.0001 AT4G31805 93 / 2e-21 WRKY family transcription factor (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023175 pacid=23170289 polypeptide=Lus10023175 locus=Lus10023175.g ID=Lus10023175.BGIv1.0 annot-version=v1.0 ATGAAAACTGAGGGCTTCCTTAAAGTTATGCAGGCAAAGGTTTCATCATCATCAGGAATAAGATATGAGCCAGAGGAGCATATTGATACTTATTCGCAAC CCCGGGGAGTAGTACCATCTGAACTTGACAAGAAACCGTATCATGTGCTGATTCAGCAGCAGGGAAGTCAAATTTTTGAGCTGGAATCAGAACTGTACTT TGCACAAGAGAAGCTCCAGGAGAAGGAAGCTGAGCTTCGAGCTCTGAAGGACTGCGTGAAGCGTCTCACTGAGGTTTCTCTGTCAAATGTTTCAGGCACG TCCTCTTAA
AA sequence Show only first row Show all	>Lus10023175 pacid=23170289 polypeptide=Lus10023175 locus=Lus10023175.g ID=Lus10023175.BGIv1.0 annot-version=v1.0 MKTEGFLKVMQAKVSSSSGIRYEPEEHIDTYSQPRGVVPSELDKKPYHVLIQQQGSQIFELESELYFAQEKLQEKEAELRALKDCVKRLTEVSLSNVSGT SS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09730			unknown protein		Lus10023175 [exp]	0	1
					Lus10018591 [exp]	3.9	0.8100
					Lus10010253 [exp]	4.6	0.8372
					Lus10027774 [exp]	6.5	0.8252
					Lus10022865 [exp]	11.2	0.7203
AT2G18180			Sec14p-like phosphatidylinosit...		Lus10028332 [exp]	16.5	0.8240
AT1G77460			Armadillo/beta-catenin-like re...		Lus10029691 [exp]	21.2	0.6853
AT4G28320		MAN5, AtMAN5	endo-beta-mannase 5, Glycosyl ...		Lus10039719 [exp]	21.8	0.8115
AT1G14930			Polyketide cyclase/dehydrase a...		Lus10042490 [exp]	27.7	0.7535
AT2G27410	B3		Domain of unknown function (DU...		Lus10038980 [exp]	33.7	0.7149
AT5G18410		ATSRA1, KLK, PI...	PIROGI 121, PIROGI, KLUNKER, t...		Lus10003109 [exp]	35.9	0.7512

Compare expression of checked genes

Lus10023175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.