Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37120 47 / 3e-08 S1FA-like DNA-binding protein (.1) AT3G09735 41 / 3e-06 S1FA-like DNA-binding protein (.1) AT3G53370 37 / 0.0002 S1FA-like DNA-binding protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015073 [exp] 126 / 2e-39 AT2G37120 68 / 1e-16 S1FA-like DNA-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G087400 [exp] 83 / 2e-22 AT3G09735 41 / 3e-06 S1FA-like DNA-binding protein (.1) Potri.006G130200 [exp] 81 / 9e-22 AT3G09735 / S1FA-like DNA-binding protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04689 [flax] [poplar] S1FA DNA binding protein S1FA
Representative CDS sequence Show only first row Show all	>Lus10023177 pacid=23170312 polypeptide=Lus10023177 locus=Lus10023177.g ID=Lus10023177.BGIv1.0 annot-version=v1.0 ATGTCCGACGATTCCGAGTTCGCCGATCACTCCACTCCCTCATTTGAGCGCATGGGAAAGGCGATGAAGGACGCGGAGGCTAAAGGGTTCAACCCAGGAC TGATAGTGTTGCTGGTTATAGGAACCCTGGTTCTGGCATTCCTGATCGGGAATTATGCGCTGTACATGTATGCTCAGAAGACTCTTCCTGCTAGGAAGAA GAAGCCAGTGTCCAAGAAGAAGATGAAGAGGGAAAGACTGAAGCAAGGCGTGTCTGCACCTGGAGAGTGA
AA sequence Show only first row Show all	>Lus10023177 pacid=23170312 polypeptide=Lus10023177 locus=Lus10023177.g ID=Lus10023177.BGIv1.0 annot-version=v1.0 MSDDSEFADHSTPSFERMGKAMKDAEAKGFNPGLIVLLVIGTLVLAFLIGNYALYMYAQKTLPARKKKPVSKKKMKRERLKQGVSAPGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37120			S1FA-like DNA-binding protein ...		Lus10023177 [exp]	0	1
AT5G59460			scarecrow-like transcription f...		Lus10004969 [exp]	5.3	0.8632
AT5G51510			unknown protein		Lus10027200 [exp]	5.8	0.8626
AT3G60360		EDA14, UTP11	U3 SMALL NUCLEOLAR RNA-ASSOCIA...		Lus10029059 [exp]	6.3	0.8264
AT3G18760			Translation elongation factor...		Lus10038301 [exp]	8.1	0.8618
AT1G12390			Cornichon family protein (.1)		Lus10004320 [exp]	8.4	0.8277
AT2G37120			S1FA-like DNA-binding protein ...		Lus10015073 [exp]	9.2	0.7906
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	10.0	0.8543
AT1G07170			PHF5-like protein (.1.2.3)		Lus10018253 [exp]	10.7	0.8006
AT2G23940			Protein of unknown function (D...		Lus10041903 [exp]	11.4	0.8371
AT4G04780		MED21	mediator 21 (.1)		Lus10024509 [exp]	12.0	0.8019

Compare expression of checked genes

Lus10023177 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.