Lus10023178 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09740 348 / 1e-121 ATSYP71, SYP71 syntaxin of plants 71 (.1)
AT3G61450 280 / 3e-95 ATSYP73, SYP73 syntaxin of plants 73 (.1.2)
AT3G45280 279 / 2e-94 ATSYP72, SYP72 syntaxin of plants 72 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015075 447 / 5e-161 AT3G09740 417 / 3e-149 syntaxin of plants 71 (.1)
Lus10019925 402 / 6e-143 AT3G09740 419 / 2e-149 syntaxin of plants 71 (.1)
Lus10026495 392 / 6e-139 AT3G09740 408 / 5e-145 syntaxin of plants 71 (.1)
Lus10036118 298 / 8e-102 AT3G45280 363 / 3e-127 syntaxin of plants 72 (.1)
Lus10036377 298 / 1e-97 AT3G09740 347 / 8e-117 syntaxin of plants 71 (.1)
Lus10014759 292 / 2e-95 AT3G09740 308 / 4e-102 syntaxin of plants 71 (.1)
Lus10007411 59 / 5e-11 AT3G09740 65 / 1e-13 syntaxin of plants 71 (.1)
Lus10037092 42 / 0.0002 AT1G13890 327 / 1e-113 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10016577 42 / 0.0002 AT1G79590 319 / 1e-111 syntaxin of plants 52 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G129500 359 / 4e-126 AT3G09740 377 / 3e-133 syntaxin of plants 71 (.1)
Potri.016G088200 355 / 1e-124 AT3G09740 384 / 3e-136 syntaxin of plants 71 (.1)
Potri.014G087400 303 / 3e-104 AT3G09740 352 / 2e-123 syntaxin of plants 71 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
Representative CDS sequence
>Lus10023178 pacid=23170294 polypeptide=Lus10023178 locus=Lus10023178.g ID=Lus10023178.BGIv1.0 annot-version=v1.0
ATGAGCGTGATCGACCTTCTCACAAGAGTCGACTCAATCTGCCAGAAGTACGAGAGATACGACGTCGACAAGCAGAAGAATCTCAATGTCTCCGGCGACG
ACGCTTTCGCTCGCGGATACGCTGCAGTTGACGCCGAAATCGAAGCCGCTCTTGAGAAATCAGAACTTGCTGCCAGTGAGAAGAGTAAGGCGTCCACTGT
AGCTCTCAATGCCGAGCTTCGTCGAACCAAGGCAAGACTGCTAGAAGAAGTTCCAAAGTTGCAGAGGCTTGCGGTAAAGAAGGTAAAAGGCCTTTCTACA
GAAGAGCTTACTGCCCGTAATGACTTGGTTCTTGCATTGCCTGACAGAATCCAAGCTATTCCAGATGGAAATACAGCTCCACTGAAACAAACTGGAGGTT
GGGGACCCTCAGCTTCCCGCACAGAAATCAAGTTTGATTCAGATGGCCGTTTTGATGATGAATATTTTCAAGAATCTGAGCAGTCGAGTCAGTTTAGGCA
GGAGTATGAAACACGTAAAAAGAAGCAGGATCATGGTCTGGAGATGATCTCCGAAGGTTTGGATACTTTGAAGAACATGGCTCATGACATGAATGAGGAA
ATGGACAGGCAAGCTCCTCTGGCGGATGAAATTGATGCCAAGGTGGATAAGGCAGCTTCTGATCTTAAGAACACTAATGTTAGACTGAAGGACACTGTTA
CACAGTTACGATCCAGCAGAAACTTCTGCATCGATATTGTTTTGTTGTGCGTGATATTGGGCATTGCTGCTTATCTGTTCAATGCGCTGAAGAACTGA
AA sequence
>Lus10023178 pacid=23170294 polypeptide=Lus10023178 locus=Lus10023178.g ID=Lus10023178.BGIv1.0 annot-version=v1.0
MSVIDLLTRVDSICQKYERYDVDKQKNLNVSGDDAFARGYAAVDAEIEAALEKSELAASEKSKASTVALNAELRRTKARLLEEVPKLQRLAVKKVKGLST
EELTARNDLVLALPDRIQAIPDGNTAPLKQTGGWGPSASRTEIKFDSDGRFDDEYFQESEQSSQFRQEYETRKKKQDHGLEMISEGLDTLKNMAHDMNEE
MDRQAPLADEIDAKVDKAASDLKNTNVRLKDTVTQLRSSRNFCIDIVLLCVILGIAAYLFNALKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10023178 0 1
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10015075 3.2 0.8831
AT5G42190 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubi... Lus10005610 15.3 0.8517
AT3G02780 IDI2, IPIAT1, I... ATISOPENTENYL DIPHOSPHE ISOMER... Lus10026834 15.7 0.8347
AT5G38660 APE1 acclimation of photosynthesis ... Lus10034073 22.8 0.8346
AT5G57330 Galactose mutarotase-like supe... Lus10015540 28.4 0.8324
AT5G42190 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubi... Lus10017282 36.2 0.8309
AT2G27600 ATSKD1, VPS4, S... VACUOLAR PROTEIN SORTING 4, SU... Lus10004891 43.3 0.8191
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10023242 48.2 0.8197
AT1G63830 PLAC8 family protein (.1.2.3) Lus10028774 49.0 0.7330
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10028280 50.3 0.7780

Lus10023178 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.