Lus10023180 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65980 268 / 2e-93 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT1G65970 259 / 3e-90 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G60740 257 / 4e-89 Thioredoxin superfamily protein (.1)
AT1G65990 189 / 9e-58 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
AT3G52960 177 / 1e-56 Thioredoxin superfamily protein (.1)
AT3G06050 108 / 5e-30 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015077 328 / 2e-117 AT1G65980 268 / 3e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10023662 314 / 2e-111 AT1G65980 264 / 5e-92 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10002843 177 / 1e-56 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10003373 177 / 2e-56 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10021932 109 / 7e-30 AT3G06050 317 / 6e-111 peroxiredoxin IIF (.1)
Lus10041218 94 / 8e-23 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G423500 283 / 1e-99 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.018G083500 280 / 5e-98 AT1G65980 280 / 4e-98 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.013G102100 175 / 4e-56 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.019G024000 101 / 3e-27 AT3G06050 311 / 2e-109 peroxiredoxin IIF (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Lus10023180 pacid=23170446 polypeptide=Lus10023180 locus=Lus10023180.g ID=Lus10023180.BGIv1.0 annot-version=v1.0
ATGGCTCCGATAGCTGCCGGTGCTTCCTTACCTGACGGAACTCTCGCTCACTTCGACGAGAACGATCAGCTCCAGCAGGTCTCCATCCACTCGCTCGCCG
CCGGCAAGAAGGTCGTCATCGTCGGTGTCCCCGGCGCCTTCACTCCAACTTGCAGCTTGAAGCATGTACCTGGATTCATCGAAAGAGCGGATGACCTCAA
AGCCAAAGGTGTTGCAGAGATAATCACTATTAGCGTGAATGATCCATTTGTGATGAAAGCTTGGGCAAAGACCTTCCCAGAGAACAAGCACGTGAAGTTC
TTGGCAGATGGCTCTGCAACTTACACCCATGCTCTGGGTGTTGAGCTTGACCTAAAAGAGAAGGGACTAGGGATCAGGTCAAGGAGGTTTGCTCTACTGG
TCGATGACCTCAAGGTGAAGGCTGCAAACATTGAAGAGGGTGGAGACTTCACAGTTTCAAGTGTTGATGATATCATCAAGGCCCTTGATGCTTGA
AA sequence
>Lus10023180 pacid=23170446 polypeptide=Lus10023180 locus=Lus10023180.g ID=Lus10023180.BGIv1.0 annot-version=v1.0
MAPIAAGASLPDGTLAHFDENDQLQQVSIHSLAAGKKVVIVGVPGAFTPTCSLKHVPGFIERADDLKAKGVAEIITISVNDPFVMKAWAKTFPENKHVKF
LADGSATYTHALGVELDLKEKGLGIRSRRFALLVDDLKVKAANIEEGGDFTVSSVDDIIKALDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65980 TPX1 thioredoxin-dependent peroxida... Lus10023180 0 1
AT1G04770 Tetratricopeptide repeat (TPR)... Lus10011738 1.0 0.8390
AT5G24660 LSU2 response to low sulfur 2 (.1) Lus10015594 3.2 0.7194
AT1G68570 Major facilitator superfamily ... Lus10017817 21.5 0.5702
AT1G07510 FTSH10 FTSH protease 10 (.1) Lus10004972 23.9 0.6325
AT1G79010 Alpha-helical ferredoxin (.1) Lus10040456 26.8 0.6244
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10020390 34.9 0.6124
AT3G62820 Plant invertase/pectin methyle... Lus10007873 40.0 0.6323
AT1G08630 THA1 threonine aldolase 1 (.1.2.3.4... Lus10000556 52.7 0.5869
AT3G04310 unknown protein Lus10032791 63.0 0.5575
AT1G78020 Protein of unknown function (D... Lus10000693 72.3 0.5860

Lus10023180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.