Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42300 140 / 1e-45 UBL5 ubiquitin-like protein 5 (.1) AT3G45180 137 / 1e-44 Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002228 [exp] 148 / 9e-49 AT5G42300 140 / 1e-45 ubiquitin-like protein 5 (.1) Lus10019939 [exp] 144 / 3e-47 AT5G42300 141 / 5e-46 ubiquitin-like protein 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G223100 [exp] 143 / 9e-47 AT5G42300 144 / 2e-47 ubiquitin-like protein 5 (.1) Potri.008G039100 [exp] 141 / 5e-46 AT5G42300 147 / 2e-48 ubiquitin-like protein 5 (.1) Potri.004G211600 [exp] 140 / 8e-46 AT3G45180 143 / 1e-46 Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10023188 pacid=23170311 polypeptide=Lus10023188 locus=Lus10023188.g ID=Lus10023188.BGIv1.0 annot-version=v1.0 ATGTTGGAAGTTGTGTTGAACGACAGGCTGGGGAAGAAGGTAAGGGTGAAGTGCAACGAAGATGACACCATCGGCGACCTGAAGAAGCTGGTTGCTGCGC AGACTGGAACCAAGGCCGAGAAGATTAGGATTCAGAAGTGGTACACCATCTACAAGGACCATATCACCCTTGGTGACTACGAGATTCACGATGGCATGGG CCTCGAGCTCTACTACAATTAA
AA sequence Show only first row Show all	>Lus10023188 pacid=23170311 polypeptide=Lus10023188 locus=Lus10023188.g ID=Lus10023188.BGIv1.0 annot-version=v1.0 MLEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTKAEKIRIQKWYTIYKDHITLGDYEIHDGMGLELYYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10023188 [exp]	0	1
AT4G08230			glycine-rich protein (.1.2)		Lus10024100 [exp]	1.0	0.9230
AT4G39235			unknown protein		Lus10004160 [exp]	1.4	0.9050
AT1G20225			Thioredoxin superfamily protei...		Lus10005616 [exp]	2.8	0.8637
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	3.2	0.8626
AT3G23490		CYN	cyanase (.1)		Lus10018091 [exp]	3.7	0.8358
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Lus10009706 [exp]	4.2	0.8611
AT4G14880		OLD3, CYTACS1, ...	ONSET OF LEAF DEATH 3, O-acety...		Lus10019003 [exp]	5.7	0.8349
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	6.2	0.8303
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10003977 [exp]	6.5	0.8738
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10015714 [exp]	7.2	0.8374

Compare expression of checked genes

Lus10023188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.