Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37210 364 / 6e-130 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT2G28305 352 / 5e-125 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT3G53450 352 / 7e-125 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT5G06300 322 / 4e-113 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT2G35990 303 / 1e-105 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT4G35190 296 / 2e-102 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT5G11950 271 / 3e-93 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 263 / 2e-89 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 145 / 2e-44 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 44 / 5e-05 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002226 [exp] 434 / 2e-157 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10026513 [exp] 386 / 2e-138 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10016096 [exp] 356 / 2e-126 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10021462 [exp] 355 / 4e-126 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10012436 [exp] 320 / 6e-112 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10024328 [exp] 313 / 2e-109 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10003335 [exp] 308 / 2e-107 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10022638 [exp] 307 / 8e-107 AT4G35190 365 / 2e-129 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 307 / 9e-107 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G127400 [exp] 386 / 3e-138 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.016G090500 [exp] 380 / 4e-136 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 354 / 6e-126 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 353 / 1e-125 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.005G237600 [exp] 329 / 6e-116 AT5G06300 338 / 2e-119 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.002G024000 [exp] 326 / 2e-114 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.006G204800 [exp] 315 / 1e-110 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.002G012500 [exp] 315 / 2e-110 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.004G181800 [exp] 308 / 3e-107 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.005G248900 [exp] 307 / 3e-107 AT4G35190 297 / 7e-103 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [flax] [poplar] SLOG PF03641 [flax] [poplar] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Lus10023190 pacid=23170299 polypeptide=Lus10023190 locus=Lus10023190.g ID=Lus10023190.BGIv1.0 annot-version=v1.0 ATGCAAGAAGAGAGTGAAATTATTAGGCCACCTTCAAAGTTCAAGAGGATTTGTGTCTTCTGTGGGAGTAGTCAGGGGAAGAAAAGTAGCTATCAGGATG CTGCTATTCAGCTTGCCCATGAATTGGTTTCAAGGAACATCGATCTGGTGTATGGTGGGGGCAGCATAGGTCTGATGGGTTTGGTATCACAAGCAGTTCA TGATGGCGGGCGCCATGTTATTGGAGTTATTCCCAAGACGCTCATGCCTCGAGAGCTAACTGGGGAGACAGTAGGGGAAGTGAAGGCAGTTGCAGGGATG CATCAAAGGAAGGCAGAAATGGCTAAACATTCAGACGCCTTTATTGCTTTACCAGGTGGCTATGGGACCCTGGAAGAGTTGCTTGAAGTCATAACATGGG CTCAACTTGGAATTCATGATAAACCAGTGGGACTGCTGAACGTGGATGGATACTACAATGCTTTACTCTCCTTCATCGACAAAGCCGTGGAAGAAGAATT CATCAGTCCTAGTGCCCGCTACATCATCGTCTCTGCACCTAATGCCAAAGAGTTGGATTATGTACCTTGCCACGAAAGGGTTGCTTCAAAACTGAACTGG GAAATAGAGCATCTGGGCTATGCTCAGAACTATGATATCTCTAGATGA
AA sequence Show only first row Show all	>Lus10023190 pacid=23170299 polypeptide=Lus10023190 locus=Lus10023190.g ID=Lus10023190.BGIv1.0 annot-version=v1.0 MQEESEIIRPPSKFKRICVFCGSSQGKKSSYQDAAIQLAHELVSRNIDLVYGGGSIGLMGLVSQAVHDGGRHVIGVIPKTLMPRELTGETVGEVKAVAGM HQRKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNALLSFIDKAVEEEFISPSARYIIVSAPNAKELDYVPCHERVASKLNW EIEHLGYAQNYDISR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Lus10023190 [exp]	0	1
AT1G06980			unknown protein		Lus10038171 [exp]	1.0	0.8504
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10007748 [exp]	2.8	0.8303
AT1G11080		SCPL31	serine carboxypeptidase-like 3...		Lus10018467 [exp]	3.7	0.7927
AT1G22790			unknown protein		Lus10028691 [exp]	3.9	0.8154
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10018674 [exp]	4.2	0.8175
AT1G04360			RING/U-box superfamily protein...		Lus10000710 [exp]	5.7	0.7880
AT2G22120			RING/FYVE/PHD zinc finger supe...		Lus10014172 [exp]	5.7	0.8155
AT2G46690			SAUR-like auxin-responsive pro...		Lus10008845 [exp]	9.2	0.7975
AT3G52900			Family of unknown function (DU...		Lus10043423 [exp]	9.5	0.7830
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Lus10002226 [exp]	13.0	0.7485

Compare expression of checked genes

Lus10023190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.