Lus10023194 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G06090 47 / 2e-07 Plant self-incompatibility protein S1 family (.1)
AT4G16195 45 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT1G04645 41 / 2e-05 Plant self-incompatibility protein S1 family (.1)
AT5G04347 41 / 3e-05 Plant self-incompatibility protein S1 family (.1)
AT5G04350 40 / 9e-05 Plant self-incompatibility protein S1 family (.1)
AT5G12060 40 / 0.0001 Plant self-incompatibility protein S1 family (.1)
AT4G16295 39 / 0.0003 SPH1 S-protein homologue 1 (.1)
AT3G26880 38 / 0.0005 Plant self-incompatibility protein S1 family (.1)
AT4G29035 38 / 0.0006 Plant self-incompatibility protein S1 family (.1)
AT5G06020 38 / 0.0007 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023193 183 / 5e-61 ND 37 / 6e-04
Lus10023025 177 / 1e-58 ND 39 / 1e-04
Lus10023196 164 / 2e-53 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1)
Lus10023195 155 / 6e-50 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Lus10002219 129 / 8e-40 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1)
Lus10002747 85 / 3e-22 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10016329 81 / 2e-20 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Lus10018785 74 / 7e-18 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1)
Lus10016330 73 / 2e-17 AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G066900 65 / 7e-14 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 54 / 9e-10 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.010G008300 52 / 3e-09 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.004G199700 49 / 9e-08 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.006G170200 48 / 1e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 45 / 1e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 44 / 3e-06 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.018G148630 43 / 1e-05 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
Potri.018G148700 40 / 0.0001 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10023194 pacid=23170352 polypeptide=Lus10023194 locus=Lus10023194.g ID=Lus10023194.BGIv1.0 annot-version=v1.0
ATGTTCATGATAAGCAAGGCTACTCTGATCCCTCCTGCAAAAGCATCGCTGATGTTTATTTTGGCAGCAATGATGATGTTAATAAAGCGAAGCGATCAGA
AGATGGAGTGGCCGAGTAAGGAGACGGTGCATGTTGGTAATGCGCTAGCTATCGATTTGATAGTGCACTGTCGATCCAAAGACGATGATCTTGGCGCGCA
TATTGTTCGCGTTAAGTCGGAGTTTAATTGGAGTTTCACGGGATACGGAATTACTCTGTTTTGGTGCGATGTAGCTGTGCAAGACAAACGTGCTGCTTTC
GTTGCCTTCGATGGCCATGGATACTGCCCACTCCACTGGTTTGTGGATGACACTGGGGTTCATGCTAATGAAACTGGATGTGAACCTACTCATATTCCAT
GGCCTTAA
AA sequence
>Lus10023194 pacid=23170352 polypeptide=Lus10023194 locus=Lus10023194.g ID=Lus10023194.BGIv1.0 annot-version=v1.0
MFMISKATLIPPAKASLMFILAAMMMLIKRSDQKMEWPSKETVHVGNALAIDLIVHCRSKDDDLGAHIVRVKSEFNWSFTGYGITLFWCDVAVQDKRAAF
VAFDGHGYCPLHWFVDDTGVHANETGCEPTHIPWP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G06090 Plant self-incompatibility pro... Lus10023194 0 1

Lus10023194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.