Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) AT2G06090 50 / 8e-09 Plant self-incompatibility protein S1 family (.1) AT4G16195 44 / 4e-06 Plant self-incompatibility protein S1 family (.1) AT3G26880 42 / 1e-05 Plant self-incompatibility protein S1 family (.1) AT5G12070 42 / 1e-05 Plant self-incompatibility protein S1 family (.1) AT3G16970 41 / 2e-05 Plant self-incompatibility protein S1 family (.1) AT5G04347 41 / 2e-05 Plant self-incompatibility protein S1 family (.1) AT1G04645 39 / 0.0001 Plant self-incompatibility protein S1 family (.1) AT3G17080 39 / 0.0002 Plant self-incompatibility protein S1 family (.1) AT4G24974 38 / 0.0003 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023196 [exp] 204 / 1e-69 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1) Lus10023194 [exp] 160 / 5e-52 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) Lus10002219 [exp] 159 / 7e-52 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1) Lus10023193 [exp] 154 / 1e-49 ND 37 / 6e-04 Lus10023025 [exp] 151 / 2e-48 ND 39 / 1e-04 Lus10002747 [exp] 89 / 3e-24 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10016330 [exp] 89 / 7e-24 AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 88 / 3e-23 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10023085 [exp] 79 / 5e-20 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 71 / 1e-16 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 56 / 4e-11 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 50 / 1e-08 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.017G144361 [exp] 49 / 5e-08 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 44 / 2e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 44 / 3e-06 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.018G148630 [exp] 44 / 3e-06 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148700 [exp] 43 / 7e-06 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 41 / 2e-05 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 40 / 9e-05 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10023195 pacid=23170417 polypeptide=Lus10023195 locus=Lus10023195.g ID=Lus10023195.BGIv1.0 annot-version=v1.0 ATGGTGGTTTTGGCAGCTACGATAGTAATGAAGGGGAGCGGCGAGTGGTCATGGCCGTCTGGGGAGACCATGCATATCACCAATGAGCTAAGCTTGGAAC TAATCGTGCATTGTCAATCCGGAGATGATGATCTCGGCGCTCAGGTTCTTGCCGTTAACTCGGAGTATAATTGGTCTTTCACTGCATACGGGTTTACCCT CTTTTGGTGCAATGTAGCTGTTCAAGATAAACGTGCTCATTTCGATGCGTTCGACGGTAGCGGGTATTGCCCTTTTCACTGGGTGGTCAATGATACCGGC GTTTATTCCGATGAGCCTGGATGTTCGGTCGATCATATTCCATGGCCGTCTTTTAGATGA
AA sequence Show only first row Show all	>Lus10023195 pacid=23170417 polypeptide=Lus10023195 locus=Lus10023195.g ID=Lus10023195.BGIv1.0 annot-version=v1.0 MVVLAATIVMKGSGEWSWPSGETMHITNELSLELIVHCQSGDDDLGAQVLAVNSEYNWSFTAYGFTLFWCNVAVQDKRAHFDAFDGSGYCPFHWVVNDTG VYSDEPGCSVDHIPWPSFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	0	1
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	1.0	1.0000
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	1.4	1.0000
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	2.0	0.9986
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	2.4	0.9987
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	3.2	0.9978
AT2G26390			Serine protease inhibitor (SER...		Lus10039336 [exp]	3.2	0.9905
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	3.5	0.9965
					Lus10019810 [exp]	3.6	0.9625
AT1G76810			eukaryotic translation initiat...		Lus10023474 [exp]	3.7	0.9962
AT3G24060			Plant self-incompatibility pro...		Lus10017719 [exp]	4.2	0.9913

Compare expression of checked genes

Lus10023195 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.