Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06090 55 / 3e-10 Plant self-incompatibility protein S1 family (.1) AT5G12060 45 / 9e-07 Plant self-incompatibility protein S1 family (.1) AT4G16195 42 / 2e-05 Plant self-incompatibility protein S1 family (.1) AT1G04645 41 / 2e-05 Plant self-incompatibility protein S1 family (.1) AT5G12070 40 / 7e-05 Plant self-incompatibility protein S1 family (.1) AT5G04047 39 / 0.0002 Plant self-incompatibility protein S1 family (.1) AT3G10460 39 / 0.0003 Plant self-incompatibility protein S1 family (.1) AT5G04350 37 / 0.0007 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023195 [exp] 205 / 1e-69 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10023194 [exp] 176 / 4e-58 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) Lus10023193 [exp] 161 / 2e-52 ND 37 / 6e-04 Lus10023025 [exp] 154 / 2e-49 ND 39 / 1e-04 Lus10002219 [exp] 135 / 1e-42 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 88 / 3e-23 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 86 / 1e-22 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10016330 [exp] 81 / 9e-21 AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10023085 [exp] 72 / 4e-17 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 73 / 4e-17 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 48 / 1e-07 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.010G008300 [exp] 47 / 1e-07 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 44 / 3e-06 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 43 / 5e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 43 / 7e-06 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.018G148700 [exp] 42 / 2e-05 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10023196 pacid=23170403 polypeptide=Lus10023196 locus=Lus10023196.g ID=Lus10023196.BGIv1.0 annot-version=v1.0 ATGATGAGGAAGGCGAAATCATTGGTGATGTTGGTTTTGGCTGCTATGATAGTAATGAAGGGGAGCGGTGAGTGGTCATGGCCGTCGAAGGAGACGATGC ATATCAGCAACGAGCTAGGCATGGAATTAATCGTGCATTGTCAATCCGGAGATGATGATCTCAAGGCTCATGTAGTTCCAGTTAACTCCGAGTACAATTG GCAATTCACTGGATTCGGGATTACACTGTTTTGGTGCAGAGTAGCTGTGGAAGATAAACGAGCTGATTTCGTTGCGTTCGACGGACACGGATACTGCCCC TTCCACTGGGTGGTCAATGATACCGGGGTTTATTCCAACGAGGATGGATGTTCAACTGATCATATTCCATGGCCCATCTTCTAG
AA sequence Show only first row Show all	>Lus10023196 pacid=23170403 polypeptide=Lus10023196 locus=Lus10023196.g ID=Lus10023196.BGIv1.0 annot-version=v1.0 MMRKAKSLVMLVLAAMIVMKGSGEWSWPSKETMHISNELGMELIVHCQSGDDDLKAHVVPVNSEYNWQFTGFGITLFWCRVAVEDKRADFVAFDGHGYCP FHWVVNDTGVYSNEDGCSTDHIPWPIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G06090			Plant self-incompatibility pro...		Lus10023196 [exp]	0	1
AT3G04950			unknown protein		Lus10022395 [exp]	3.0	0.6897
AT4G00350			MATE efflux family protein (.1...		Lus10036374 [exp]	6.2	0.7636
					Lus10011637 [exp]	10.3	0.7366
AT3G20050		ATTCP-1	T-complex protein 1 alpha subu...		Lus10036714 [exp]	11.1	0.7200
					Lus10015636 [exp]	13.7	0.6961
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	15.2	0.7055
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	18.0	0.6990
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	19.7	0.6990
AT1G02030	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10031166 [exp]	21.4	0.6884
AT5G18020			SAUR-like auxin-responsive pro...		Lus10027690 [exp]	21.5	0.6761

Compare expression of checked genes

Lus10023196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.